eF-site ID 1ey6-A PDB Code 1ey6 Chain A click to enlarge Title STRUCTURE OF S. NUCLEASE STABILIZING MUTANT T41I Classification HYDROLASE Compound STAPHYLOCOCCAL NUCLEASE Source Staphylococcus aureus (NUC_STAAU) Sequence A:  LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDIPETKH PKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYG RGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLR KSEAQAKKEKLNIWS Description Functional site 1) chain A residue 21 type catalytic sequence D description 165 source MCSA : MCSA1 2) chain A residue 35 type catalytic sequence R description 165 source MCSA : MCSA1 3) chain A residue 40 type catalytic sequence D description 165 source MCSA : MCSA1 4) chain A residue 41 type catalytic sequence I description 165 source MCSA : MCSA1 5) chain A residue 43 type catalytic sequence E description 165 source MCSA : MCSA1 6) chain A residue 87 type catalytic sequence R description 165 source MCSA : MCSA1 7) chain A residue 21 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 8) chain A residue 40 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 9) chain A residue 41 type BINDING sequence I description source Swiss-Prot : SWS_FT_FI2 10) chain A residue 35 type ACT_SITE sequence R description ACT_SITE => ECO:0000269|PubMed:288045 source Swiss-Prot : SWS_FT_FI1 11) chain A residue 43 type ACT_SITE sequence E description ACT_SITE => ECO:0000269|PubMed:288045 source Swiss-Prot : SWS_FT_FI1 12) chain A residue 87 type ACT_SITE sequence R description ACT_SITE => ECO:0000269|PubMed:288045 source Swiss-Prot : SWS_FT_FI1 13) chain A residue 19-43 type prosite sequence DGDTVKLMYKGQPMTFRLLLVDIPE description TNASE_1 Thermonuclease family signature 1. DGDTVkLmykgqpmtf.RLllVDiPE source prosite : PS01123 14) chain A residue 83-93 type prosite sequence DKYGRGLAYIY description TNASE_2 Thermonuclease family signature 2. DKYGRgLAyIY source prosite : PS01284

Display surface Download Links