eF-site ID 1evz-A PDB Code 1evz Chain A click to enlarge Title CRYSTAL STRUCTURE OF LEISHMANIA MEXICANA GLYCEROL-3-PHOSPHATE DEHYDROGENASE IN COMPLEX WITH NAD Classification OXIDOREDUCTASE Compound GLYCEROL-3-PHOSPHATE DEHYDROGENASE Source Leishmania mexicana (P90551_LEIME) Sequence A:  KDELLYLNKAVVFGSGAFGTALAMVLSKKCREVCVWHMNE EEVRLVNEKRENVLFLKGVQLASNITFTSDVEKAYNGAEI ILFVIPTQFLRGFFEKSGGNLIAYAKEKQVPVLVCTKGIE RSTLKFPAEIIGEFLPSPLLSVLAGPSFAIEVATGVFTCV SIASADINVARRLQRIMSTGDRSFVCWATTDTVGCEVASA VKNVLAIGSGVANGLGMGLNARAALIMRGLLEIRDLTAAL GGDGSAVFGLAGLGDLQLTCSSELSRNFTVGKKLGKGLPI EEIQRAVAEGVATADPLMRLAKQLKVKMPLCHQIYEIVYK KKNPRDALADLLSCGLQDEGLPPLFK Description Functional site 1) chain A residue 23 type sequence S description BINDING SITE FOR RESIDUE NAD A 400 source : AC1 2) chain A residue 24 type sequence G description BINDING SITE FOR RESIDUE NAD A 400 source : AC1 3) chain A residue 25 type sequence A description BINDING SITE FOR RESIDUE NAD A 400 source : AC1 4) chain A residue 26 type sequence F description BINDING SITE FOR RESIDUE NAD A 400 source : AC1 5) chain A residue 45 type sequence H description BINDING SITE FOR RESIDUE NAD A 400 source : AC1 6) chain A residue 46 type sequence M description BINDING SITE FOR RESIDUE NAD A 400 source : AC1 7) chain A residue 63 type sequence F description BINDING SITE FOR RESIDUE NAD A 400 source : AC1 8) chain A residue 94 type sequence P description BINDING SITE FOR RESIDUE NAD A 400 source : AC1 9) chain A residue 97 type sequence F description BINDING SITE FOR RESIDUE NAD A 400 source : AC1 10) chain A residue 124 type sequence T description BINDING SITE FOR RESIDUE NAD A 400 source : AC1 11) chain A residue 125 type sequence K description BINDING SITE FOR RESIDUE NAD A 400 source : AC1 12) chain A residue 155 type sequence S description BINDING SITE FOR RESIDUE NAD A 400 source : AC1 13) chain A residue 157 type sequence A description BINDING SITE FOR RESIDUE NAD A 400 source : AC1 14) chain A residue 300 type sequence E description BINDING SITE FOR RESIDUE NAD A 400 source : AC1 15) chain A residue 219 type sequence V description BINDING SITE FOR RESIDUE MYS A 500 source : AC2 16) chain A residue 220 type sequence A description BINDING SITE FOR RESIDUE MYS A 500 source : AC2 17) chain A residue 342 type sequence L description BINDING SITE FOR RESIDUE MYS A 500 source : AC2 18) chain A residue 345 type sequence C description BINDING SITE FOR RESIDUE MYS A 500 source : AC2 19) chain A residue 210 type catalytic sequence K description 593 source MCSA : MCSA1 20) chain A residue 267 type catalytic sequence T description 593 source MCSA : MCSA1 21) chain A residue 207-228 type prosite sequence SAVKNVLAIGSGVANGLGMGLN description NAD_G3PDH NAD-dependent glycerol-3-phosphate dehydrogenase signature. SAVKNVLAiGsGVanGLgMGlN source prosite : PS00957 22) chain A residue 210 type ACT_SITE sequence K description Proton acceptor => ECO:0000305 source Swiss-Prot : SWS_FT_FI1 23) chain A residue 22 type BINDING sequence G description BINDING => ECO:0000269|PubMed:10801498, ECO:0000269|PubMed:12758080 source Swiss-Prot : SWS_FT_FI2 24) chain A residue 157 type BINDING sequence A description BINDING => ECO:0000269|PubMed:10801498, ECO:0000269|PubMed:12758080 source Swiss-Prot : SWS_FT_FI2 25) chain A residue 298 type BINDING sequence V description BINDING => ECO:0000269|PubMed:10801498, ECO:0000269|PubMed:12758080 source Swiss-Prot : SWS_FT_FI2 26) chain A residue 300 type BINDING sequence E description BINDING => ECO:0000269|PubMed:10801498, ECO:0000269|PubMed:12758080 source Swiss-Prot : SWS_FT_FI2 27) chain A residue 97 type BINDING sequence F description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI3 28) chain A residue 274 type BINDING sequence R description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI3 29) chain A residue 125 type BINDING sequence K description BINDING => ECO:0000269|PubMed:12758080 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links