eF-site ID 1ev6-F PDB Code 1ev6 Chain F click to enlarge Title Structure of the monoclinic form of the M-cresol/insulin R6 hexamer Classification HORMONE/GROWTH FACTOR Compound INSULIN Source (INS_HUMAN) Sequence F:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT Description (1)  INSULIN Functional site 1) chain F residue 10 type sequence H description BINDING SITE FOR RESIDUE ZN B 301 source : AC1 2) chain F residue 10 type sequence H description BINDING SITE FOR RESIDUE CL B 303 source : AC3 3) chain F residue 5 type sequence H description BINDING SITE FOR RESIDUE CRS A 306 source : AC6 4) chain F residue 7 type sequence C description BINDING SITE FOR RESIDUE CRS E 308 source : AC8 5) chain F residue 10 type sequence H description BINDING SITE FOR RESIDUE CRS E 308 source : AC8 6) chain F residue 11 type sequence L description BINDING SITE FOR RESIDUE CRS E 308 source : AC8 7) chain F residue 14 type sequence A description BINDING SITE FOR RESIDUE CRS E 308 source : AC8 8) chain F residue 17 type sequence L description BINDING SITE FOR RESIDUE CRS K 311 source : BC2

Display surface Download Links