eF-site ID 1esk_1-A PDB Code 1esk Model 1 Chain A click to enlarge Title SOLUTION STRUCTURE OF NCP7 FROM HIV-1 Classification VIRAL PROTEIN Compound GAG POLYPROTEIN Source Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) (POL_HV1H2) Sequence A:  NVKCFNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTE RQ Description Functional site 1) chain A residue 15 type sequence C description BINDING SITE FOR RESIDUE ZN A 54 source : AC1 2) chain A residue 18 type sequence C description BINDING SITE FOR RESIDUE ZN A 54 source : AC1 3) chain A residue 23 type sequence H description BINDING SITE FOR RESIDUE ZN A 54 source : AC1 4) chain A residue 28 type sequence C description BINDING SITE FOR RESIDUE ZN A 54 source : AC1 5) chain A residue 36 type sequence C description BINDING SITE FOR RESIDUE ZN A 55 source : AC2 6) chain A residue 39 type sequence C description BINDING SITE FOR RESIDUE ZN A 55 source : AC2 7) chain A residue 44 type sequence H description BINDING SITE FOR RESIDUE ZN A 55 source : AC2 8) chain A residue 49 type sequence C description BINDING SITE FOR RESIDUE ZN A 55 source : AC2 9) chain A residue 51 type sequence E description BINDING SITE FOR RESIDUE ZN A 55 source : AC2 10) chain A residue 14-31 type ZN_FING sequence KCFNCGKEGHTARNCRAP description CCHC-type 1 => ECO:0000255|PROSITE-ProRule:PRU00047 source Swiss-Prot : SWS_FT_FI1 11) chain A residue 35-52 type ZN_FING sequence GCWKCGKEGHQMKDCTER description CCHC-type 2 => ECO:0000255|PROSITE-ProRule:PRU00047 source Swiss-Prot : SWS_FT_FI2 12) chain A residue 17 type SITE sequence N description Cleavage; by viral protease => ECO:0000255 source Swiss-Prot : SWS_FT_FI3 13) chain A residue 50 type SITE sequence T description Cleavage; by viral protease => ECO:0000255 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links