eF-site ID 1eqz-E PDB Code 1eqz Chain E click to enlarge Title X-RAY STRUCTURE OF THE NUCLEOSOME CORE PARTICLE AT 2.5 A RESOLUTION Classification STRUCTURAL PROTEIN/DNA Compound 146 NUCLEOTIDES LONG DNA Source ORGANISM_COMMON: chicken; ORGANISM_SCIENTIFIC: Gallus gallus; Sequence E:  GRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAE RVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPR HLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTD SHKAKAK Description Functional site 1) chain E residue 44 type sequence G description BINDING SITE FOR RESIDUE CL E 450 source : AC2 2) chain E residue 46 type sequence G description BINDING SITE FOR RESIDUE CL E 450 source : AC2 3) chain E residue 47 type sequence A description BINDING SITE FOR RESIDUE CL E 450 source : AC2 4) chain E residue 120 type MOD_RES sequence T description N6-glutaryllysine; alternate => ECO:0000250|UniProtKB:P62805 source Swiss-Prot : SWS_FT_FI10 5) chain E residue 10 type MOD_RES sequence A description Symmetric dimethylarginine; by PRMT5 and PRMT7; alternate => ECO:0000250|UniProtKB:P62805 source Swiss-Prot : SWS_FT_FI3 6) chain E residue 96 type MOD_RES sequence L description Symmetric dimethylarginine; by PRMT5 and PRMT7; alternate => ECO:0000250|UniProtKB:P62805 source Swiss-Prot : SWS_FT_FI3 7) chain E residue 119 type MOD_RES sequence K description Phosphoserine; by PAK2 => ECO:0000250|UniProtKB:P62805 source Swiss-Prot : SWS_FT_FI8 8) chain E residue 120 type MOD_RES sequence T description Phosphoserine; by PAK2 => ECO:0000250|UniProtKB:P62805 source Swiss-Prot : SWS_FT_FI8

Display surface Download Links