eF-site ID 1eo7-A
PDB Code 1eo7
Chain A

click to enlarge
Title BACILLUS CIRCULANS STRAIN 251 CYCLODEXTRIN GLYCOSYLTRANSFERASE IN COMPLEX WITH MALTOHEXAOSE
Classification TRANSFERASE
Compound PROTEIN (CYCLODEXTRIN GLYCOSYLTRANSFERASE)
Source Bacillus circulans (CDGU_BACCI)
Sequence A:  APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFD
GTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPV
ENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQN
LIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDN
GTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADL
NHNNSTVDVYLKDAIKMWLDLGIDGIRMAAVKHMPFGWQK
SFMAAVNNYKPVFTFGAWFLGVNEVSPENHKFANESGMSL
LDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQ
VTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYY
GTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKS
NPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNA
PASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNF
TLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGR
GFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGN
YNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTAL
GQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDV
SVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATI
NVNWQP
Description (1)  CYCLODEXTRIN GLYCOSYLTRANSFERASE (E.C.2.4.1.19)


Functional site

1) chain A
residue 100
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE GLC A 691
source : AC1

2) chain A
residue 140
type
ligand
sequence H
description BINDING SITE FOR RESIDUE GLC A 691
source : AC1

3) chain A
residue 194
type
ligand
sequence L
description BINDING SITE FOR RESIDUE GLC A 691
source : AC1

4) chain A
residue 197
type
ligand
sequence L
description BINDING SITE FOR RESIDUE GLC A 691
source : AC1

5) chain A
residue 227
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GLC A 691
source : AC1

6) chain A
residue 229
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GLC A 691
source : AC1

7) chain A
residue 230
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GLC A 691
source : AC1

8) chain A
residue 327
type
ligand
sequence H
description BINDING SITE FOR RESIDUE GLC A 691
source : AC1

9) chain A
residue 328
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GLC A 691
source : AC1

10) chain A
residue 375
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GLC A 691
source : AC1

11) chain A
residue 98
type
ligand
sequence H
description BINDING SITE FOR RESIDUE GLC A 692
source : AC2

12) chain A
residue 100
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE GLC A 692
source : AC2

13) chain A
residue 101
type
ligand
sequence W
description BINDING SITE FOR RESIDUE GLC A 692
source : AC2

14) chain A
residue 371
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GLC A 692
source : AC2

15) chain A
residue 375
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GLC A 692
source : AC2

16) chain A
residue 89
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE GLC A 693
source : AC3

17) chain A
residue 371
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GLC A 693
source : AC3

18) chain A
residue 195
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE GLC A 694
source : AC4

19) chain A
residue 180
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GLC A 695
source : AC5

20) chain A
residue 195
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE GLC A 695
source : AC5

21) chain A
residue 144
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GLC A 696
source : AC6

22) chain A
residue 145
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GLC A 696
source : AC6

23) chain A
residue 180
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GLC A 696
source : AC6

24) chain A
residue 193
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GLC A 696
source : AC6

25) chain A
residue 195
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE GLC A 696
source : AC6

26) chain A
residue 196
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GLC A 696
source : AC6

27) chain A
residue 457
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GLC A 696
source : AC6

28) chain A
residue 339
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GLC A 698
source : AC7

29) chain A
residue 384
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GLC A 698
source : AC7

30) chain A
residue 651
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GLC A 699
source : AC8

31) chain A
residue 662
type
ligand
sequence W
description BINDING SITE FOR RESIDUE GLC A 699
source : AC8

32) chain A
residue 663
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GLC A 699
source : AC8

33) chain A
residue 616
type
ligand
sequence W
description BINDING SITE FOR RESIDUE GLC A 700
source : AC9

34) chain A
residue 667
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GLC A 700
source : AC9

35) chain A
residue 600
type
ligand
sequence L
description BINDING SITE FOR RESIDUE GLC A 702
source : BC1

36) chain A
residue 598
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GLC A 703
source : BC2

37) chain A
residue 599
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GLC A 703
source : BC2

38) chain A
residue 600
type
ligand
sequence L
description BINDING SITE FOR RESIDUE GLC A 703
source : BC2

39) chain A
residue 599
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GLC A 704
source : BC3

40) chain A
residue 600
type
ligand
sequence L
description BINDING SITE FOR RESIDUE GLC A 704
source : BC3

41) chain A
residue 601
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GLC A 704
source : BC3

42) chain A
residue 602
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE GLC A 704
source : BC3

43) chain A
residue 603
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GLC A 704
source : BC3

44) chain A
residue 627
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GLC A 704
source : BC3

45) chain A
residue 628
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE GLC A 704
source : BC3

46) chain A
residue 603
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GLC A 705
source : BC4

47) chain A
residue 413
type
ligand
sequence W
description BINDING SITE FOR RESIDUE GLC A 707
source : BC5

48) chain A
residue 414
type
ligand
sequence I
description BINDING SITE FOR RESIDUE GLC A 707
source : BC5

49) chain A
residue 445
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GLC A 707
source : BC5

50) chain A
residue 446
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GLC A 707
source : BC5

51) chain A
residue 539
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GLC A 707
source : BC5

52) chain A
residue 540
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GLC A 707
source : BC5

53) chain A
residue 411
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GLC A 708
source : BC6

54) chain A
residue 412
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GLC A 708
source : BC6

55) chain A
residue 446
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GLC A 708
source : BC6

56) chain A
residue 448
type
ligand
sequence V
description BINDING SITE FOR RESIDUE GLC A 708
source : BC6

57) chain A
residue 27
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA A 688
source : BC8

58) chain A
residue 29
type
ligand
sequence N
description BINDING SITE FOR RESIDUE CA A 688
source : BC8

59) chain A
residue 32
type
ligand
sequence N
description BINDING SITE FOR RESIDUE CA A 688
source : BC8

60) chain A
residue 33
type
ligand
sequence N
description BINDING SITE FOR RESIDUE CA A 688
source : BC8

61) chain A
residue 51
type
ligand
sequence G
description BINDING SITE FOR RESIDUE CA A 688
source : BC8

62) chain A
residue 53
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA A 688
source : BC8

63) chain A
residue 139
type
ligand
sequence N
description BINDING SITE FOR RESIDUE CA A 689
source : BC9

64) chain A
residue 190
type
ligand
sequence I
description BINDING SITE FOR RESIDUE CA A 689
source : BC9

65) chain A
residue 199
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA A 689
source : BC9

66) chain A
residue 233
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CA A 689
source : BC9

67) chain A
residue 315
type
ligand
sequence A
description BINDING SITE FOR RESIDUE CA A 690
source : CC1

68) chain A
residue 577
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA A 690
source : CC1

69) chain A
residue 257
type ACT_SITE
ligand
sequence A
description Proton donor.
source Swiss-Prot : SWS_FT_FI1

70) chain A
residue 229
type ACT_SITE
ligand
sequence A
description Nucleophile.
source Swiss-Prot : SWS_FT_FI2

71) chain A
residue 29
type METAL
ligand
sequence N
description Calcium 1; via carbonyl oxygen
source Swiss-Prot : SWS_FT_FI3

72) chain A
residue 51
type METAL
ligand
sequence G
description Calcium 1; via carbonyl oxygen
source Swiss-Prot : SWS_FT_FI3

73) chain A
residue 577
type METAL
ligand
sequence D
description Calcium 3
source Swiss-Prot : SWS_FT_FI4

74) chain A
residue 139
type METAL
ligand
sequence N
description Calcium 2
source Swiss-Prot : SWS_FT_FI5

75) chain A
residue 199
type METAL
ligand
sequence D
description Calcium 2
source Swiss-Prot : SWS_FT_FI5

76) chain A
residue 190
type METAL
ligand
sequence I
description Calcium 2; via carbonyl oxygen
source Swiss-Prot : SWS_FT_FI6

77) chain A
residue 233
type METAL
ligand
sequence H
description Calcium 2; via carbonyl oxygen
source Swiss-Prot : SWS_FT_FI6

78) chain A
residue 27
type METAL
ligand
sequence D
description Calcium 1
source Swiss-Prot : SWS_FT_FI7

79) chain A
residue 32
type METAL
ligand
sequence N
description Calcium 1
source Swiss-Prot : SWS_FT_FI7

80) chain A
residue 33
type METAL
ligand
sequence N
description Calcium 1
source Swiss-Prot : SWS_FT_FI7

81) chain A
residue 53
type METAL
ligand
sequence D
description Calcium 1
source Swiss-Prot : SWS_FT_FI7

82) chain A
residue 315
type METAL
ligand
sequence A
description Calcium 3; via carbonyl oxygen
source Swiss-Prot : SWS_FT_FI8

83) chain A
residue 140
type BINDING
ligand
sequence H
description Substrate.
source Swiss-Prot : SWS_FT_FI9

84) chain A
residue 227
type BINDING
ligand
sequence R
description Substrate.
source Swiss-Prot : SWS_FT_FI9

85) chain A
residue 327
type BINDING
ligand
sequence H
description Substrate.
source Swiss-Prot : SWS_FT_FI9

86) chain A
residue 371
type BINDING
ligand
sequence D
description Substrate.
source Swiss-Prot : SWS_FT_FI9

87) chain A
residue 375
type BINDING
ligand
sequence R
description Substrate.
source Swiss-Prot : SWS_FT_FI9

88) chain A
residue 328
type SITE
ligand
sequence D
description Transition state stabilizer (By similarity).
source Swiss-Prot : SWS_FT_FI10

89) chain A
residue 21
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence F
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_692

90) chain A
residue 97-98
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence YH
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_692

91) chain A
residue 100-101
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence YW
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_692

92) chain A
residue 195-197
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence YDL
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_692

93) chain A
residue 327-328
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence HD
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_692

94) chain A
residue 371
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence D
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_692

95) chain A
residue 375
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence R
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_692

96) chain A
residue 89
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence Y
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_693

97) chain A
residue 94
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence N
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_693

98) chain A
residue 101
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence W
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_693

99) chain A
residue 195-196
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence YD
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_693

100) chain A
residue 371
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence D
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_693

101) chain A
residue 89
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence Y
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_694

102) chain A
residue 195-196
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence YD
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_694

103) chain A
residue 100
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence Y
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_691

104) chain A
residue 135
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence D
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_691

105) chain A
residue 137
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence A
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_691

106) chain A
residue 140
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence H
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_691

107) chain A
residue 194
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence L
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_691

108) chain A
residue 197
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence L
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_691

109) chain A
residue 227
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence R
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_691

110) chain A
residue 229-230
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence AA
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_691

111) chain A
residue 257
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence A
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_691

112) chain A
residue 327-328
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence HD
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_691

113) chain A
residue 375
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence R
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_691

114) chain A
residue 144-145
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence AS
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_696

115) chain A
residue 167
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence Y
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_696

116) chain A
residue 179-180
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence GG
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_696

117) chain A
residue 193
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence N
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_696

118) chain A
residue 195-197
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence YDL
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_696

119) chain A
residue 180-181
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence GT
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_695

120) chain A
residue 193
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence N
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_695

121) chain A
residue 195-196
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence YD
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_695

122) chain A
residue 185
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence T
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_705

123) chain A
residue 601
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence G
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_705

124) chain A
residue 603
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence N
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_705

125) chain A
residue 628
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence Q
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_705

126) chain A
residue 411-414
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence ERWI
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_708

127) chain A
residue 446-448
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence GLV
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_708

128) chain A
residue 411-415
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence ERWIN
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_707

129) chain A
residue 445-447
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence SGL
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_707

130) chain A
residue 598-600
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence TAL
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_703

131) chain A
residue 602
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence Q
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_703

132) chain A
residue 627
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence N
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_703

133) chain A
residue 633
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence Y
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_703

134) chain A
residue 598-603
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence TALGQN
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_704

135) chain A
residue 627-628
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence NQ
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_704

136) chain A
residue 636
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence W
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_704

137) chain A
residue 600
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence L
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_702

138) chain A
residue 616
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence W
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_700

139) chain A
residue 649
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence E
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_700

140) chain A
residue 651
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence K
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_700

141) chain A
residue 662
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence W
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_700

142) chain A
residue 667
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence N
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_700

143) chain A
residue 651
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence K
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_699

144) chain A
residue 662-663
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence WE
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_699

145) chain A
residue 667
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence N
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1eo7_A_699


Display surface

Download
Links