eF-site ID 1el4-A PDB Code 1el4 Chain A click to enlarge Title STRUCTURE OF THE CALCIUM-REGULATED PHOTOPROTEIN OBELIN DETERMINED BY SULFUR SAS Classification LUMINESCENT PROTEIN Compound OBELIN Source Obelia longissima (Black sea hydrozoan) (Laomedea longissima) (OBL_OBELO) Sequence A:  SSKYAVKLKTDFDNPRWIKRHKHMFDFLDINGNGKITLDE IVSKASDDICAKLEATPEQTKRHQVCVEAFFRGCGMEYGK EIAFPQFLDGWKQLATSELKKWARNEPTLIREWGDAVFDI FDKDGSGTITLDEWKAYGKISGISPSQEDCEATFRHCDLD NSGDLDVDEMTRQHLGFWYTLDPEADGLYGNGVP Description Functional site 1) chain A residue 112 type sequence R description BINDING SITE FOR RESIDUE CL A 196 source : AC1 2) chain A residue 172 type sequence T description BINDING SITE FOR RESIDUE CL A 196 source : AC1 3) chain A residue 22 type sequence H description BINDING SITE FOR RESIDUE CTZ A 197 source : AC2 4) chain A residue 25 type sequence M description BINDING SITE FOR RESIDUE CTZ A 197 source : AC2 5) chain A residue 42 type sequence I description BINDING SITE FOR RESIDUE CTZ A 197 source : AC2 6) chain A residue 50 type sequence I description BINDING SITE FOR RESIDUE CTZ A 197 source : AC2 7) chain A residue 88 type sequence F description BINDING SITE FOR RESIDUE CTZ A 197 source : AC2 8) chain A residue 92 type sequence W description BINDING SITE FOR RESIDUE CTZ A 197 source : AC2 9) chain A residue 114 type sequence W description BINDING SITE FOR RESIDUE CTZ A 197 source : AC2 10) chain A residue 115 type sequence G description BINDING SITE FOR RESIDUE CTZ A 197 source : AC2 11) chain A residue 119 type sequence F description BINDING SITE FOR RESIDUE CTZ A 197 source : AC2 12) chain A residue 135 type sequence W description BINDING SITE FOR RESIDUE CTZ A 197 source : AC2 13) chain A residue 138 type sequence Y description BINDING SITE FOR RESIDUE CTZ A 197 source : AC2 14) chain A residue 171 type sequence M description BINDING SITE FOR RESIDUE CTZ A 197 source : AC2 15) chain A residue 175 type sequence H description BINDING SITE FOR RESIDUE CTZ A 197 source : AC2 16) chain A residue 179 type sequence W description BINDING SITE FOR RESIDUE CTZ A 197 source : AC2 17) chain A residue 190 type sequence Y description BINDING SITE FOR RESIDUE CTZ A 197 source : AC2 18) chain A residue 22 type catalytic sequence H description 768 source MCSA : MCSA1 19) chain A residue 92 type catalytic sequence W description 768 source MCSA : MCSA1 20) chain A residue 138 type catalytic sequence Y description 768 source MCSA : MCSA1 21) chain A residue 175 type catalytic sequence H description 768 source MCSA : MCSA1 22) chain A residue 190 type catalytic sequence Y description 768 source MCSA : MCSA1 23) chain A residue 30 type BINDING sequence D description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 24) chain A residue 134 type BINDING sequence E description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 25) chain A residue 159 type BINDING sequence D description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 26) chain A residue 161 type BINDING sequence D description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 27) chain A residue 163 type BINDING sequence S description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 28) chain A residue 165 type BINDING sequence D description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 29) chain A residue 170 type BINDING sequence E description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 30) chain A residue 32 type BINDING sequence N description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 31) chain A residue 34 type BINDING sequence N description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 32) chain A residue 36 type BINDING sequence K description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 33) chain A residue 41 type BINDING sequence E description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 34) chain A residue 123 type BINDING sequence D description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 35) chain A residue 125 type BINDING sequence D description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 36) chain A residue 127 type BINDING sequence S description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 37) chain A residue 129 type BINDING sequence T description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 38) chain A residue 30-42 type prosite sequence DINGNGKITLDEI description EF_HAND_1 EF-hand calcium-binding domain. DINGNGKITldEI source prosite : PS00018 39) chain A residue 123-135 type prosite sequence DKDGSGTITLDEW description EF_HAND_1 EF-hand calcium-binding domain. DINGNGKITldEI source prosite : PS00018 40) chain A residue 159-171 type prosite sequence DLDNSGDLDVDEM description EF_HAND_1 EF-hand calcium-binding domain. DINGNGKITldEI source prosite : PS00018

Display surface Download Links