eF-site ID 1ecd-A PDB Code 1ecd Chain A click to enlarge Title STRUCTURE OF ERYTHROCRUORIN IN DIFFERENT LIGAND STATES REFINED AT 1.4 ANGSTROMS RESOLUTION Classification OXYGEN TRANSPORT Compound ERYTHROCRUORIN (AQUO MET) Source null (GLB3_CHITH) Sequence A:  LSADQISTVQASFDKVKGDPVGILYAVFKADPSIMAKFTQ FAGKDLESIKGTAPFETHANRIVGFFSKIIGELPNIEADV NTFVASHKPRGVTHDQLNNFRAGFVSYMKAHTDFAGAEAA WGATLDTFFGMIFSKM Description Functional site 1) chain A residue 4 type sequence D description BINDING SITE FOR RESIDUE HEM A 137 source : AC1 2) chain A residue 7 type sequence S description BINDING SITE FOR RESIDUE HEM A 137 source : AC1 3) chain A residue 8 type sequence T description BINDING SITE FOR RESIDUE HEM A 137 source : AC1 4) chain A residue 37 type sequence K description BINDING SITE FOR RESIDUE HEM A 137 source : AC1 5) chain A residue 38 type sequence F description BINDING SITE FOR RESIDUE HEM A 137 source : AC1 6) chain A residue 58 type sequence H description BINDING SITE FOR RESIDUE HEM A 137 source : AC1 7) chain A residue 61 type sequence R description BINDING SITE FOR RESIDUE HEM A 137 source : AC1 8) chain A residue 62 type sequence I description BINDING SITE FOR RESIDUE HEM A 137 source : AC1 9) chain A residue 65 type sequence F description BINDING SITE FOR RESIDUE HEM A 137 source : AC1 10) chain A residue 83 type sequence F description BINDING SITE FOR RESIDUE HEM A 137 source : AC1 11) chain A residue 87 type sequence H description BINDING SITE FOR RESIDUE HEM A 137 source : AC1 12) chain A residue 90 type sequence R description BINDING SITE FOR RESIDUE HEM A 137 source : AC1 13) chain A residue 92 type sequence V description BINDING SITE FOR RESIDUE HEM A 137 source : AC1 14) chain A residue 96 type sequence Q description BINDING SITE FOR RESIDUE HEM A 137 source : AC1 15) chain A residue 97 type sequence L description BINDING SITE FOR RESIDUE HEM A 137 source : AC1 16) chain A residue 100 type sequence F description BINDING SITE FOR RESIDUE HEM A 137 source : AC1 17) chain A residue 58 type BINDING sequence H description axial binding residue source Swiss-Prot : SWS_FT_FI1 18) chain A residue 87 type BINDING sequence H description axial binding residue source Swiss-Prot : SWS_FT_FI1

Display surface Download Links