eF-site ID 1e6j-L
PDB Code 1e6j
Chain L

click to enlarge
Title Crystal structure of HIV-1 capsid protein (p24) in complex with Fab13B5
Classification VIRAL PROTEIN
Compound IMMUNOGLOBULIN
Source ORGANISM_COMMON: HOUSE MOUSE; ORGANISM_SCIENTIFIC: MUS MUSCULUS;
Sequence L:  EIVLTQSPAITAASLGQKVTITCSASSSVSYMHWYQQKSG
TSPKPWIYEISKLASGVPARFSGSGSGTSYSLTISSMEAE
DAAIYYCQQWNYPFTFGSGTKLEIKRADAAPTVSIFPPSS
EQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNS
WTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTST
SPIVKSFNRN
Description (1)  IMMUNOGLOBULIN, CAPSID PROTEIN P24


Functional site

1) chain L
residue 190-196
type prosite
ligand
sequence YTCEATH
description Immunoglobulins and major histocompatibility complex proteins signature.[FY]-{L}-C-{PGAD}-[VA]-{LC}-H.
source prosite : PS00290


Display surface

Download
Links