eF-site ID 1e6j-H
PDB Code 1e6j
Chain H

click to enlarge
Title Crystal structure of HIV-1 capsid protein (p24) in complex with Fab13B5
Classification VIRAL PROTEIN
Compound IMMUNOGLOBULIN
Source ORGANISM_COMMON: HOUSE MOUSE; ORGANISM_SCIENTIFIC: MUS MUSCULUS;
Sequence H:  EVQLQQSGAELARPGASVKMSCKASGYTFTSYTMHWVKQR
PGQGLEWIGYINPSSGYSNYNQKFKDKATLTADKSSSTAY
MQLSSLTSEDSAVYYCSRPVVRLGYNFDYWGQGSTLTVSS
AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVT
WNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETV
TCNVAHPASSTKVDKKIVP
Description (1)  IMMUNOGLOBULIN, CAPSID PROTEIN P24

Display surface

Download
Links