eF-site ID 1e6e-D PDB Code 1e6e Chain D click to enlarge Title ADRENODOXIN REDUCTASE/ADRENODOXIN COMPLEX OF MITOCHONDRIAL P450 SYSTEMS Classification OXIDOREDUCTASE Compound NADPH\:ADRENODOXIN OXIDOREDUCTASE Source (ADX1_BOVIN) Sequence D:  DKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFG ACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGL TDRSRLGCQICLTKAMDNMTVRVPDA Description Functional site 1) chain D residue 44 type sequence G description BINDING SITE FOR RESIDUE FES D 129 source : AC9 2) chain D residue 46 type sequence C description BINDING SITE FOR RESIDUE FES D 129 source : AC9 3) chain D residue 48 type sequence G description BINDING SITE FOR RESIDUE FES D 129 source : AC9 4) chain D residue 50 type sequence L description BINDING SITE FOR RESIDUE FES D 129 source : AC9 5) chain D residue 52 type sequence C description BINDING SITE FOR RESIDUE FES D 129 source : AC9 6) chain D residue 55 type sequence C description BINDING SITE FOR RESIDUE FES D 129 source : AC9 7) chain D residue 92 type sequence C description BINDING SITE FOR RESIDUE FES D 129 source : AC9 8) chain D residue 6 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:P46656 source Swiss-Prot : SWS_FT_FI3 9) chain D residue 98 type MOD_RES sequence K description N6-succinyllysine => ECO:0000250|UniProtKB:P46656 source Swiss-Prot : SWS_FT_FI4 10) chain D residue 46 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 11) chain D residue 52 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 12) chain D residue 55 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 13) chain D residue 92 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links