eF-site ID 1e4u_18-A PDB Code 1e4u Model 18 Chain A click to enlarge Title N-terminal RING finger domain of human NOT-4 Classification GENE REGULATION Compound TRANSCRIPTIONAL REPRESSOR NOT4 Source (O95628) Sequence A:  MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRF CWHRIRTDENGLCPACRKPYPEDPAVYKPLSQEELQRI Description (1)  TRANSCRIPTIONAL REPRESSOR NOT4 Functional site 1) chain A residue 14 type sequence C description BINDING SITE FOR RESIDUE ZN A 79 source : AC1 2) chain A residue 17 type sequence C description BINDING SITE FOR RESIDUE ZN A 79 source : AC1 3) chain A residue 38 type sequence C description BINDING SITE FOR RESIDUE ZN A 79 source : AC1 4) chain A residue 41 type sequence C description BINDING SITE FOR RESIDUE ZN A 79 source : AC1 5) chain A residue 31 type sequence C description BINDING SITE FOR RESIDUE ZN A 80 source : AC2 6) chain A residue 33 type sequence C description BINDING SITE FOR RESIDUE ZN A 80 source : AC2 7) chain A residue 53 type sequence C description BINDING SITE FOR RESIDUE ZN A 80 source : AC2 8) chain A residue 56 type sequence C description BINDING SITE FOR RESIDUE ZN A 80 source : AC2 9) chain A residue 14-57 type ZN_FING sequence CPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLC PACR description RING-type; degenerate => ECO:0000255|PROSITE-ProRule:PRU00175 source Swiss-Prot : SWS_FT_FI1 10) chain A residue 71 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:17525332 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links