eF-site ID 1e2o-A
PDB Code 1e2o
Chain A

click to enlarge
Title CATALYTIC DOMAIN FROM DIHYDROLIPOAMIDE SUCCINYLTRANSFERASE
Classification TRANSFERASE
Compound DIHYDROLIPOAMIDE SUCCINYLTRANSFERASE
Source Escherichia coli (strain K12) (ODO2_ECOLI)
Sequence A:  ARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKP
IMDLRKQYGEAFEKRHGIRLGFMSFYVKAVVEALKRYPEV
NASIDGDDVVYHNYFDVSMAVSTGLVTPVLRDVDTLGMAD
IEKKIKELAVKGDGKLTVEDLTGGNFTITNGGVFGSLMST
PIINPPQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYD
HRLIDGRESVGFLVTIKELLEDPTRLLLDV
Description (1)  DIHYDROLIPOAMIDE SUCCINYLTRANSFERASE


Functional site

1) chain A
residue 195
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SO4 A 421
source : AC1

2) chain A
residue 195
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SO4 A 421
source : AC1

3) chain A
residue 195
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SO4 A 421
source : AC1

4) chain A
residue 196
type
ligand
sequence N
description BINDING SITE FOR RESIDUE SO4 A 421
source : AC1

5) chain A
residue 196
type
ligand
sequence N
description BINDING SITE FOR RESIDUE SO4 A 421
source : AC1

6) chain A
residue 204
type ACT_SITE
ligand
sequence F
description
source Swiss-Prot : SWS_FT_FI1

7) chain A
residue 208
type ACT_SITE
ligand
sequence N
description
source Swiss-Prot : SWS_FT_FI1


Display surface

Download
Links