eF-site ID 1dz5_5-B
PDB Code 1dz5
Model 5
Chain B

click to enlarge
Title The NMR structure of the 38KDa U1A protein-PIE RNA complex reveals the basis of cooperativity in regulation of polyadenylation by human U1A protein
Classification RIBONUCLEOPROTEIN/RNA
Compound U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
Source Homo sapiens (Human) (1DZ5)
Sequence B:  AVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQIL
DILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKP
MRIQYAKTDSDIIAKMKGTFV
Description (1)  U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A

Display surface

Download
Links