eF-site ID 1dz5_3-ABCD
PDB Code 1dz5
Model 3
Chain A, B, C, D

click to enlarge
Title The NMR structure of the 38KDa U1A protein-PIE RNA complex reveals the basis of cooperativity in regulation of polyadenylation by human U1A protein
Classification RIBONUCLEOPROTEIN/RNA
Compound U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
Source Homo sapiens (Human) (1DZ5)
Sequence A:  AVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQIL
DILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKP
MRIQYAKTDSDIIAKMKGTFV
B:  AVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQIL
DILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKP
MRIQYAKTDSDIIAKMKGTFV
C:  GAGACAUUGCACCCGGAGUCUC
D:  GAGACAUUGCACCCGGAGUCUC
Description (1)  U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A

Display surface

Download
Links