eF-site ID 1dz1_8-B PDB Code 1dz1 Model 8 Chain B click to enlarge Title Mouse HP1 (M31) C terminal (shadow chromo) domain Classification CHROMATIN STRUCTURE Compound MODIFIER 1 PROTEIN Source Mus musculus (Mouse) (CBX1_MOUSE) Sequence B:  HMKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNS DEADLVPAKEANVKCPQVVISFYEERLTWH Description (1)  MODIFIER 1 PROTEIN Functional site 1) chain B residue 126 type SITE sequence T description Interacts with the PxVxL motif of TRIM28/TIF1B source Swiss-Prot : SWS_FT_FI1 2) chain B residue 135 type SITE sequence L description Interacts with the PxVxL motif of TRIM28/TIF1B source Swiss-Prot : SWS_FT_FI1 3) chain B residue 146 type SITE sequence L description Interacts with the PxVxL motif of TRIM28/TIF1B source Swiss-Prot : SWS_FT_FI1 4) chain B residue 163 type SITE sequence F description Interacts with the PxVxL motif of TRIM28/TIF1B source Swiss-Prot : SWS_FT_FI1 5) chain B residue 167 type SITE sequence R description Interacts with the PxVxL motif of TRIM28/TIF1B source Swiss-Prot : SWS_FT_FI1 6) chain B residue 168 type SITE sequence L description Interacts with the PxVxL motif of TRIM28/TIF1B source Swiss-Prot : SWS_FT_FI1 7) chain B residue 170 type SITE sequence W description Interacts with the PxVxL motif of TRIM28/TIF1B source Swiss-Prot : SWS_FT_FI1 8) chain B residue 125 type SITE sequence A description Interacts with the PxVxL motif of TRIM28/TIF1B source Swiss-Prot : SWS_FT_FI1 9) chain B residue 150 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) => ECO:0000250|UniProtKB:P83916 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links