eF-site ID 1dz1_4-AB PDB Code 1dz1 Model 4 Chain A, B click to enlarge Title Mouse HP1 (M31) C terminal (shadow chromo) domain Classification CHROMATIN STRUCTURE Compound MODIFIER 1 PROTEIN Source null (CBX1_MOUSE) Sequence A:  HMKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNS DEADLVPAKEANVKCPQVVISFYEERLTWH B:  HMKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNS DEADLVPAKEANVKCPQVVISFYEERLTWH Description (1)  MODIFIER 1 PROTEIN Functional site 1) chain B residue 150 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) => ECO:0000250|UniProtKB:P83916 source Swiss-Prot : SWS_FT_FI2 2) chain A residue 150 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) => ECO:0000250|UniProtKB:P83916 source Swiss-Prot : SWS_FT_FI2 3) chain A residue 125 type SITE sequence A description Interacts with the PxVxL motif of TRIM28/TIF1B source Swiss-Prot : SWS_FT_FI1 4) chain A residue 126 type SITE sequence T description Interacts with the PxVxL motif of TRIM28/TIF1B source Swiss-Prot : SWS_FT_FI1 5) chain A residue 135 type SITE sequence L description Interacts with the PxVxL motif of TRIM28/TIF1B source Swiss-Prot : SWS_FT_FI1 6) chain A residue 146 type SITE sequence L description Interacts with the PxVxL motif of TRIM28/TIF1B source Swiss-Prot : SWS_FT_FI1 7) chain A residue 163 type SITE sequence F description Interacts with the PxVxL motif of TRIM28/TIF1B source Swiss-Prot : SWS_FT_FI1 8) chain A residue 167 type SITE sequence R description Interacts with the PxVxL motif of TRIM28/TIF1B source Swiss-Prot : SWS_FT_FI1 9) chain A residue 168 type SITE sequence L description Interacts with the PxVxL motif of TRIM28/TIF1B source Swiss-Prot : SWS_FT_FI1 10) chain A residue 170 type SITE sequence W description Interacts with the PxVxL motif of TRIM28/TIF1B source Swiss-Prot : SWS_FT_FI1 11) chain B residue 125 type SITE sequence A description Interacts with the PxVxL motif of TRIM28/TIF1B source Swiss-Prot : SWS_FT_FI1 12) chain B residue 126 type SITE sequence T description Interacts with the PxVxL motif of TRIM28/TIF1B source Swiss-Prot : SWS_FT_FI1 13) chain B residue 135 type SITE sequence L description Interacts with the PxVxL motif of TRIM28/TIF1B source Swiss-Prot : SWS_FT_FI1 14) chain B residue 146 type SITE sequence L description Interacts with the PxVxL motif of TRIM28/TIF1B source Swiss-Prot : SWS_FT_FI1 15) chain B residue 163 type SITE sequence F description Interacts with the PxVxL motif of TRIM28/TIF1B source Swiss-Prot : SWS_FT_FI1 16) chain B residue 167 type SITE sequence R description Interacts with the PxVxL motif of TRIM28/TIF1B source Swiss-Prot : SWS_FT_FI1 17) chain B residue 168 type SITE sequence L description Interacts with the PxVxL motif of TRIM28/TIF1B source Swiss-Prot : SWS_FT_FI1 18) chain B residue 170 type SITE sequence W description Interacts with the PxVxL motif of TRIM28/TIF1B source Swiss-Prot : SWS_FT_FI1

Display surface Download Links