eF-site ID 1dz1_12-AB
PDB Code 1dz1
Model 12
Chain A, B

click to enlarge
Title Mouse HP1 (M31) C terminal (shadow chromo) domain
Classification CHROMATIN STRUCTURE
Compound MODIFIER 1 PROTEIN
Source null (CBX1_MOUSE)
Sequence A:  HMKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNS
DEADLVPAKEANVKCPQVVISFYEERLTWH
B:  HMKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNS
DEADLVPAKEANVKCPQVVISFYEERLTWH
Description (1)  MODIFIER 1 PROTEIN


Functional site

1) chain B
residue 150
type CROSSLNK
sequence K
description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) => ECO:0000250|UniProtKB:P83916
source Swiss-Prot : SWS_FT_FI2

2) chain A
residue 150
type CROSSLNK
sequence K
description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) => ECO:0000250|UniProtKB:P83916
source Swiss-Prot : SWS_FT_FI2

3) chain A
residue 125
type SITE
sequence A
description Interacts with the PxVxL motif of TRIM28/TIF1B
source Swiss-Prot : SWS_FT_FI1

4) chain A
residue 126
type SITE
sequence T
description Interacts with the PxVxL motif of TRIM28/TIF1B
source Swiss-Prot : SWS_FT_FI1

5) chain A
residue 135
type SITE
sequence L
description Interacts with the PxVxL motif of TRIM28/TIF1B
source Swiss-Prot : SWS_FT_FI1

6) chain A
residue 146
type SITE
sequence L
description Interacts with the PxVxL motif of TRIM28/TIF1B
source Swiss-Prot : SWS_FT_FI1

7) chain A
residue 163
type SITE
sequence F
description Interacts with the PxVxL motif of TRIM28/TIF1B
source Swiss-Prot : SWS_FT_FI1

8) chain A
residue 167
type SITE
sequence R
description Interacts with the PxVxL motif of TRIM28/TIF1B
source Swiss-Prot : SWS_FT_FI1

9) chain A
residue 168
type SITE
sequence L
description Interacts with the PxVxL motif of TRIM28/TIF1B
source Swiss-Prot : SWS_FT_FI1

10) chain A
residue 170
type SITE
sequence W
description Interacts with the PxVxL motif of TRIM28/TIF1B
source Swiss-Prot : SWS_FT_FI1

11) chain B
residue 125
type SITE
sequence A
description Interacts with the PxVxL motif of TRIM28/TIF1B
source Swiss-Prot : SWS_FT_FI1

12) chain B
residue 126
type SITE
sequence T
description Interacts with the PxVxL motif of TRIM28/TIF1B
source Swiss-Prot : SWS_FT_FI1

13) chain B
residue 135
type SITE
sequence L
description Interacts with the PxVxL motif of TRIM28/TIF1B
source Swiss-Prot : SWS_FT_FI1

14) chain B
residue 146
type SITE
sequence L
description Interacts with the PxVxL motif of TRIM28/TIF1B
source Swiss-Prot : SWS_FT_FI1

15) chain B
residue 163
type SITE
sequence F
description Interacts with the PxVxL motif of TRIM28/TIF1B
source Swiss-Prot : SWS_FT_FI1

16) chain B
residue 167
type SITE
sequence R
description Interacts with the PxVxL motif of TRIM28/TIF1B
source Swiss-Prot : SWS_FT_FI1

17) chain B
residue 168
type SITE
sequence L
description Interacts with the PxVxL motif of TRIM28/TIF1B
source Swiss-Prot : SWS_FT_FI1

18) chain B
residue 170
type SITE
sequence W
description Interacts with the PxVxL motif of TRIM28/TIF1B
source Swiss-Prot : SWS_FT_FI1


Display surface

Download
Links