eF-site ID 1dux-C
PDB Code 1dux
Chain C

click to enlarge
Title ELK-1/DNA STRUCTURE REVEALS HOW RESIDUES DISTAL FROM DNA-BINDING SURFACE AFFECT DNA-RECOGNITION
Classification Transcription/DNA
Compound DNA (5'-D(*TP*GP*AP*CP*CP*GP*GP*AP*AP*GP*TP*GP*T)-3')
Source Homo sapiens (Human) (1DUX)
Sequence C:  VTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVAR
LWGLRKNKTNMNYDKLSRALRYYYDKNIIRKVSGQKFVYK
FVSYPE
Description (1)  ETS-DOMAIN PROTEIN ELK-1/DNA COMPLEX


Functional site

1) chain C
residue 5-86
type DNA_BIND
ligand
sequence VTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVAR
LWGLRKNKTNMNYDKLSRALRYYYDKNIIRKVSGQKFVYK
FV
description ETS.
source Swiss-Prot : SWS_FT_FI1

2) chain C
residue 7-15
type prosite
ligand
sequence LWQFLLQLL
description Ets-domain signature 1. L-[FYW]-[QEDH]-F-[LI]-[LVQK]-{N}-[LI]-L
source prosite : PS00345

3) chain C
residue 52-67
type prosite
ligand
sequence KTNMNYDKLSRALRYY
description Ets-domain signature 2. [RKHN]-x(2)-M-x-Y-[DENQ]-x-[LIVM]-[STAG]-R-[STAG]-[LI]-R-x-Y
source prosite : PS00346


Display surface

Download
Links