eF-site ID 1dug-B
PDB Code 1dug
Chain B

click to enlarge
Title STRUCTURE OF THE FIBRINOGEN G CHAIN INTEGRIN BINDING AND FACTOR XIIIA CROSSLINKING SITES OBTAINED THROUGH CARRIER PROTEIN DRIVEN CRYSTALLIZATION
Classification transferase, blood clotting
Compound chimera of GLUTATHIONE S-TRANSFERASE-synthetic LINKEr-C-TERMINAL FIBRINOGEN GAMMA CHAIN
Source Homo sapiens (Human) (FIBG_HUMAN)
Sequence B:  SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKW
RNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNM
LGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVD
FLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDV
VLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAW
PLQGWQATFGGGDHPPKSDPQQHHLGGAKQAGDV
Description (1)  GLUTATHIONE S-TRANSFERASE LINKED TO C-TERMINAL FIBRINOGEN GAMMA CHAIN (E.C.2.5.1.18)


Functional site

1) chain B
residue 100
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GSH A 1239
source : AC1

2) chain B
residue 6
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE GSH B 1587
source : AC2

3) chain B
residue 7
type
ligand
sequence W
description BINDING SITE FOR RESIDUE GSH B 1587
source : AC2

4) chain B
residue 12
type
ligand
sequence L
description BINDING SITE FOR RESIDUE GSH B 1587
source : AC2

5) chain B
residue 40
type
ligand
sequence W
description BINDING SITE FOR RESIDUE GSH B 1587
source : AC2

6) chain B
residue 44
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GSH B 1587
source : AC2

7) chain B
residue 53
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GSH B 1587
source : AC2

8) chain B
residue 54
type
ligand
sequence L
description BINDING SITE FOR RESIDUE GSH B 1587
source : AC2

9) chain B
residue 55
type
ligand
sequence P
description BINDING SITE FOR RESIDUE GSH B 1587
source : AC2

10) chain B
residue 66
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE GSH B 1587
source : AC2

11) chain B
residue 67
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GSH B 1587
source : AC2

12) chain B
residue 96
type binding
ligand GSH: GLUTATHIONE
sequence G
description GLUTATHIONE binding site
source pdb_hetatom : GSH_1dug_A_1239

13) chain B
residue 100
type binding
ligand GSH: GLUTATHIONE
sequence D
description GLUTATHIONE binding site
source pdb_hetatom : GSH_1dug_A_1239

14) chain B
residue 6-7
type binding
ligand GSH: GLUTATHIONE
sequence YW
description GLUTATHIONE binding site
source pdb_hetatom : GSH_1dug_B_1587

15) chain B
residue 12
type binding
ligand GSH: GLUTATHIONE
sequence L
description GLUTATHIONE binding site
source pdb_hetatom : GSH_1dug_B_1587

16) chain B
residue 40
type binding
ligand GSH: GLUTATHIONE
sequence W
description GLUTATHIONE binding site
source pdb_hetatom : GSH_1dug_B_1587

17) chain B
residue 44
type binding
ligand GSH: GLUTATHIONE
sequence K
description GLUTATHIONE binding site
source pdb_hetatom : GSH_1dug_B_1587

18) chain B
residue 53-55
type binding
ligand GSH: GLUTATHIONE
sequence NLP
description GLUTATHIONE binding site
source pdb_hetatom : GSH_1dug_B_1587

19) chain B
residue 66-68
type binding
ligand GSH: GLUTATHIONE
sequence QSM
description GLUTATHIONE binding site
source pdb_hetatom : GSH_1dug_B_1587

20) chain B
residue 103
type binding
ligand GSH: GLUTATHIONE
sequence Y
description GLUTATHIONE binding site
source pdb_hetatom : GSH_1dug_B_1587

21) chain B
residue 6
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1oe8
source CSA : CSA2


Display surface

Download
Links