eF-site ID 1dug-AB
PDB Code 1dug
Chain A, B

click to enlarge
Title STRUCTURE OF THE FIBRINOGEN G CHAIN INTEGRIN BINDING AND FACTOR XIIIA CROSSLINKING SITES OBTAINED THROUGH CARRIER PROTEIN DRIVEN CRYSTALLIZATION
Classification transferase, blood clotting
Compound chimera of GLUTATHIONE S-TRANSFERASE-synthetic LINKEr-C-TERMINAL FIBRINOGEN GAMMA CHAIN
Source Homo sapiens (Human) (FIBG_HUMAN)
Sequence A:  SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKW
RNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNM
LGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVD
FLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDV
VLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAW
PLQGWQATFGGGDHPPKSDPQQHHLGGAKQAGDV
B:  SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKW
RNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNM
LGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVD
FLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDV
VLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAW
PLQGWQATFGGGDHPPKSDPQQHHLGGAKQAGDV
Description (1)  GLUTATHIONE S-TRANSFERASE LINKED TO C-TERMINAL FIBRINOGEN GAMMA CHAIN (E.C.2.5.1.18)


Functional site

1) chain A
residue 6
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE GSH A 1239
source : AC1

2) chain A
residue 7
type
ligand
sequence W
description BINDING SITE FOR RESIDUE GSH A 1239
source : AC1

3) chain A
residue 12
type
ligand
sequence L
description BINDING SITE FOR RESIDUE GSH A 1239
source : AC1

4) chain A
residue 40
type
ligand
sequence W
description BINDING SITE FOR RESIDUE GSH A 1239
source : AC1

5) chain A
residue 44
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GSH A 1239
source : AC1

6) chain A
residue 53
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GSH A 1239
source : AC1

7) chain A
residue 54
type
ligand
sequence L
description BINDING SITE FOR RESIDUE GSH A 1239
source : AC1

8) chain A
residue 55
type
ligand
sequence P
description BINDING SITE FOR RESIDUE GSH A 1239
source : AC1

9) chain A
residue 66
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE GSH A 1239
source : AC1

10) chain A
residue 67
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GSH A 1239
source : AC1

11) chain B
residue 100
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GSH A 1239
source : AC1

12) chain A
residue 100
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GSH B 1587
source : AC2

13) chain B
residue 6
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE GSH B 1587
source : AC2

14) chain B
residue 7
type
ligand
sequence W
description BINDING SITE FOR RESIDUE GSH B 1587
source : AC2

15) chain B
residue 12
type
ligand
sequence L
description BINDING SITE FOR RESIDUE GSH B 1587
source : AC2

16) chain B
residue 40
type
ligand
sequence W
description BINDING SITE FOR RESIDUE GSH B 1587
source : AC2

17) chain B
residue 44
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GSH B 1587
source : AC2

18) chain B
residue 53
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GSH B 1587
source : AC2

19) chain B
residue 54
type
ligand
sequence L
description BINDING SITE FOR RESIDUE GSH B 1587
source : AC2

20) chain B
residue 55
type
ligand
sequence P
description BINDING SITE FOR RESIDUE GSH B 1587
source : AC2

21) chain B
residue 66
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE GSH B 1587
source : AC2

22) chain B
residue 67
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GSH B 1587
source : AC2

23) chain A
residue 6-7
type binding
ligand GSH: GLUTATHIONE
sequence YW
description GLUTATHIONE binding site
source pdb_hetatom : GSH_1dug_A_1239

24) chain A
residue 12
type binding
ligand GSH: GLUTATHIONE
sequence L
description GLUTATHIONE binding site
source pdb_hetatom : GSH_1dug_A_1239

25) chain A
residue 40
type binding
ligand GSH: GLUTATHIONE
sequence W
description GLUTATHIONE binding site
source pdb_hetatom : GSH_1dug_A_1239

26) chain A
residue 44
type binding
ligand GSH: GLUTATHIONE
sequence K
description GLUTATHIONE binding site
source pdb_hetatom : GSH_1dug_A_1239

27) chain A
residue 53-55
type binding
ligand GSH: GLUTATHIONE
sequence NLP
description GLUTATHIONE binding site
source pdb_hetatom : GSH_1dug_A_1239

28) chain A
residue 66-68
type binding
ligand GSH: GLUTATHIONE
sequence QSM
description GLUTATHIONE binding site
source pdb_hetatom : GSH_1dug_A_1239

29) chain A
residue 103
type binding
ligand GSH: GLUTATHIONE
sequence Y
description GLUTATHIONE binding site
source pdb_hetatom : GSH_1dug_A_1239

30) chain B
residue 96
type binding
ligand GSH: GLUTATHIONE
sequence G
description GLUTATHIONE binding site
source pdb_hetatom : GSH_1dug_A_1239

31) chain B
residue 100
type binding
ligand GSH: GLUTATHIONE
sequence D
description GLUTATHIONE binding site
source pdb_hetatom : GSH_1dug_A_1239

32) chain A
residue 96
type binding
ligand GSH: GLUTATHIONE
sequence G
description GLUTATHIONE binding site
source pdb_hetatom : GSH_1dug_B_1587

33) chain A
residue 100
type binding
ligand GSH: GLUTATHIONE
sequence D
description GLUTATHIONE binding site
source pdb_hetatom : GSH_1dug_B_1587

34) chain B
residue 6-7
type binding
ligand GSH: GLUTATHIONE
sequence YW
description GLUTATHIONE binding site
source pdb_hetatom : GSH_1dug_B_1587

35) chain B
residue 12
type binding
ligand GSH: GLUTATHIONE
sequence L
description GLUTATHIONE binding site
source pdb_hetatom : GSH_1dug_B_1587

36) chain B
residue 40
type binding
ligand GSH: GLUTATHIONE
sequence W
description GLUTATHIONE binding site
source pdb_hetatom : GSH_1dug_B_1587

37) chain B
residue 44
type binding
ligand GSH: GLUTATHIONE
sequence K
description GLUTATHIONE binding site
source pdb_hetatom : GSH_1dug_B_1587

38) chain B
residue 53-55
type binding
ligand GSH: GLUTATHIONE
sequence NLP
description GLUTATHIONE binding site
source pdb_hetatom : GSH_1dug_B_1587

39) chain B
residue 66-68
type binding
ligand GSH: GLUTATHIONE
sequence QSM
description GLUTATHIONE binding site
source pdb_hetatom : GSH_1dug_B_1587

40) chain B
residue 103
type binding
ligand GSH: GLUTATHIONE
sequence Y
description GLUTATHIONE binding site
source pdb_hetatom : GSH_1dug_B_1587

41) chain A
residue 6
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1oe8
source CSA : CSA1

42) chain B
residue 6
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1oe8
source CSA : CSA2


Display surface

Download
Links