eF-site ID 1dug-A
PDB Code 1dug
Chain A

click to enlarge
Title STRUCTURE OF THE FIBRINOGEN G CHAIN INTEGRIN BINDING AND FACTOR XIIIA CROSSLINKING SITES OBTAINED THROUGH CARRIER PROTEIN DRIVEN CRYSTALLIZATION
Classification transferase, blood clotting
Compound chimera of GLUTATHIONE S-TRANSFERASE-synthetic LINKEr-C-TERMINAL FIBRINOGEN GAMMA CHAIN
Source Homo sapiens (Human) (FIBG_HUMAN)
Sequence A:  SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKW
RNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNM
LGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVD
FLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDV
VLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAW
PLQGWQATFGGGDHPPKSDPQQHHLGGAKQAGDV
Description (1)  GLUTATHIONE S-TRANSFERASE LINKED TO C-TERMINAL FIBRINOGEN GAMMA CHAIN (E.C.2.5.1.18)


Functional site

1) chain A
residue 6
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE GSH A 1239
source : AC1

2) chain A
residue 7
type
ligand
sequence W
description BINDING SITE FOR RESIDUE GSH A 1239
source : AC1

3) chain A
residue 12
type
ligand
sequence L
description BINDING SITE FOR RESIDUE GSH A 1239
source : AC1

4) chain A
residue 40
type
ligand
sequence W
description BINDING SITE FOR RESIDUE GSH A 1239
source : AC1

5) chain A
residue 44
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GSH A 1239
source : AC1

6) chain A
residue 53
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GSH A 1239
source : AC1

7) chain A
residue 54
type
ligand
sequence L
description BINDING SITE FOR RESIDUE GSH A 1239
source : AC1

8) chain A
residue 55
type
ligand
sequence P
description BINDING SITE FOR RESIDUE GSH A 1239
source : AC1

9) chain A
residue 66
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE GSH A 1239
source : AC1

10) chain A
residue 67
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GSH A 1239
source : AC1

11) chain A
residue 100
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GSH B 1587
source : AC2

12) chain A
residue 6-7
type binding
ligand GSH: GLUTATHIONE
sequence YW
description GLUTATHIONE binding site
source pdb_hetatom : GSH_1dug_A_1239

13) chain A
residue 12
type binding
ligand GSH: GLUTATHIONE
sequence L
description GLUTATHIONE binding site
source pdb_hetatom : GSH_1dug_A_1239

14) chain A
residue 40
type binding
ligand GSH: GLUTATHIONE
sequence W
description GLUTATHIONE binding site
source pdb_hetatom : GSH_1dug_A_1239

15) chain A
residue 44
type binding
ligand GSH: GLUTATHIONE
sequence K
description GLUTATHIONE binding site
source pdb_hetatom : GSH_1dug_A_1239

16) chain A
residue 53-55
type binding
ligand GSH: GLUTATHIONE
sequence NLP
description GLUTATHIONE binding site
source pdb_hetatom : GSH_1dug_A_1239

17) chain A
residue 66-68
type binding
ligand GSH: GLUTATHIONE
sequence QSM
description GLUTATHIONE binding site
source pdb_hetatom : GSH_1dug_A_1239

18) chain A
residue 103
type binding
ligand GSH: GLUTATHIONE
sequence Y
description GLUTATHIONE binding site
source pdb_hetatom : GSH_1dug_A_1239

19) chain A
residue 96
type binding
ligand GSH: GLUTATHIONE
sequence G
description GLUTATHIONE binding site
source pdb_hetatom : GSH_1dug_B_1587

20) chain A
residue 100
type binding
ligand GSH: GLUTATHIONE
sequence D
description GLUTATHIONE binding site
source pdb_hetatom : GSH_1dug_B_1587

21) chain A
residue 6
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1oe8
source CSA : CSA1


Display surface

Download
Links