eF-site ID 1dt7_29-B PDB Code 1dt7 Model 29 Chain B click to enlarge Title SOLUTION STRUCTURE OF THE C-TERMINAL NEGATIVE REGULATORY DOMAIN OF P53 IN A COMPLEX WITH CA2+-BOUND S100B(BB) Classification SIGNALING PROTEIN Compound S100 CALCIUM-BINDING PROTEIN Source null (P53_HUMAN) Sequence B:  MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNE LSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSM VTTACHEFFEHE Description Functional site 1) chain B residue 18 type sequence S description BINDING SITE FOR RESIDUE CA B 116 source : AC3 2) chain B residue 23 type sequence D description BINDING SITE FOR RESIDUE CA B 116 source : AC3 3) chain B residue 26 type sequence K description BINDING SITE FOR RESIDUE CA B 116 source : AC3 4) chain B residue 31 type sequence E description BINDING SITE FOR RESIDUE CA B 116 source : AC3 5) chain B residue 61 type sequence D description BINDING SITE FOR RESIDUE CA B 117 source : AC4 6) chain B residue 62 type sequence E description BINDING SITE FOR RESIDUE CA B 117 source : AC4 7) chain B residue 63 type sequence D description BINDING SITE FOR RESIDUE CA B 117 source : AC4 8) chain B residue 64 type sequence G description BINDING SITE FOR RESIDUE CA B 117 source : AC4 9) chain B residue 65 type sequence D description BINDING SITE FOR RESIDUE CA B 117 source : AC4 10) chain B residue 67 type sequence E description BINDING SITE FOR RESIDUE CA B 117 source : AC4 11) chain B residue 72 type sequence E description BINDING SITE FOR RESIDUE CA B 117 source : AC4 12) chain B residue 15 type MOD_RES sequence H description N6-methyllysine; by SMYD2; alternate => ECO:0000269|PubMed:17108971, ECO:0000269|PubMed:22864287 source Swiss-Prot : SWS_FT_FI1 13) chain B residue 25 type MOD_RES sequence H description N6-methyllysine; by SMYD2; alternate => ECO:0000269|PubMed:17108971, ECO:0000269|PubMed:22864287 source Swiss-Prot : SWS_FT_FI1 14) chain B residue 85 type MOD_RES sequence H description N6-methyllysine; by SMYD2; alternate => ECO:0000269|PubMed:17108971, ECO:0000269|PubMed:22864287 source Swiss-Prot : SWS_FT_FI1 15) chain B residue 90 type MOD_RES sequence H description N6-methyllysine; by SMYD2; alternate => ECO:0000269|PubMed:17108971, ECO:0000269|PubMed:22864287 source Swiss-Prot : SWS_FT_FI1 16) chain B residue 18 type MOD_RES sequence S description N6-methyllysine; by SETD7 => ECO:0000269|PubMed:15525938, ECO:0000269|PubMed:16415881 source Swiss-Prot : SWS_FT_FI2 17) chain B residue 21 type MOD_RES sequence E description N6-methyllysine; by SETD7 => ECO:0000269|PubMed:15525938, ECO:0000269|PubMed:16415881 source Swiss-Prot : SWS_FT_FI2 18) chain B residue 26 type MOD_RES sequence K description N6-methyllysine; by SETD7 => ECO:0000269|PubMed:15525938, ECO:0000269|PubMed:16415881 source Swiss-Prot : SWS_FT_FI2 19) chain B residue 31 type MOD_RES sequence E description N6-methyllysine; by SETD7 => ECO:0000269|PubMed:15525938, ECO:0000269|PubMed:16415881 source Swiss-Prot : SWS_FT_FI2 20) chain B residue 61 type MOD_RES sequence D description N6-acetyllysine; alternate => ECO:0000269|PubMed:10656795 source Swiss-Prot : SWS_FT_FI3 21) chain B residue 63 type MOD_RES sequence D description N6-acetyllysine; alternate => ECO:0000269|PubMed:10656795 source Swiss-Prot : SWS_FT_FI3 22) chain B residue 65 type MOD_RES sequence D description N6-acetyllysine; alternate => ECO:0000269|PubMed:10656795 source Swiss-Prot : SWS_FT_FI3 23) chain B residue 67 type MOD_RES sequence E description N6-acetyllysine; alternate => ECO:0000269|PubMed:10656795 source Swiss-Prot : SWS_FT_FI3 24) chain B residue 72 type MOD_RES sequence E description N6-acetyllysine; alternate => ECO:0000269|PubMed:10656795 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links