eF-site ID 1dt7_12-A PDB Code 1dt7 Model 12 Chain A click to enlarge Title SOLUTION STRUCTURE OF THE C-TERMINAL NEGATIVE REGULATORY DOMAIN OF P53 IN A COMPLEX WITH CA2+-BOUND S100B(BB) Classification SIGNALING PROTEIN Compound S100 CALCIUM-BINDING PROTEIN Source Rattus norvegicus (Rat) (P53_HUMAN) Sequence A:  MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNE LSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSM VTTACHEFFEHE Description Functional site 1) chain A residue 18 type sequence S description BINDING SITE FOR RESIDUE CA A 114 source : AC1 2) chain A residue 23 type sequence D description BINDING SITE FOR RESIDUE CA A 114 source : AC1 3) chain A residue 26 type sequence K description BINDING SITE FOR RESIDUE CA A 114 source : AC1 4) chain A residue 27 type sequence L description BINDING SITE FOR RESIDUE CA A 114 source : AC1 5) chain A residue 31 type sequence E description BINDING SITE FOR RESIDUE CA A 114 source : AC1 6) chain A residue 61 type sequence D description BINDING SITE FOR RESIDUE CA A 115 source : AC2 7) chain A residue 62 type sequence E description BINDING SITE FOR RESIDUE CA A 115 source : AC2 8) chain A residue 63 type sequence D description BINDING SITE FOR RESIDUE CA A 115 source : AC2 9) chain A residue 64 type sequence G description BINDING SITE FOR RESIDUE CA A 115 source : AC2 10) chain A residue 65 type sequence D description BINDING SITE FOR RESIDUE CA A 115 source : AC2 11) chain A residue 67 type sequence E description BINDING SITE FOR RESIDUE CA A 115 source : AC2 12) chain A residue 72 type sequence E description BINDING SITE FOR RESIDUE CA A 115 source : AC2 13) chain A residue 85 type MOD_RES sequence H description N6-methyllysine; by SMYD2; alternate => ECO:0000269|PubMed:17108971, ECO:0000269|PubMed:22864287 source Swiss-Prot : SWS_FT_FI1 14) chain A residue 90 type MOD_RES sequence H description N6-methyllysine; by SMYD2; alternate => ECO:0000269|PubMed:17108971, ECO:0000269|PubMed:22864287 source Swiss-Prot : SWS_FT_FI1 15) chain A residue 26 type MOD_RES sequence K description N6-methyllysine; by SETD7 => ECO:0000269|PubMed:15525938, ECO:0000269|PubMed:16415881 source Swiss-Prot : SWS_FT_FI2 16) chain A residue 31 type MOD_RES sequence E description N6-methyllysine; by SETD7 => ECO:0000269|PubMed:15525938, ECO:0000269|PubMed:16415881 source Swiss-Prot : SWS_FT_FI2 17) chain A residue 65 type MOD_RES sequence D description N6-acetyllysine; alternate => ECO:0000269|PubMed:10656795 source Swiss-Prot : SWS_FT_FI3 18) chain A residue 67 type MOD_RES sequence E description N6-acetyllysine; alternate => ECO:0000269|PubMed:10656795 source Swiss-Prot : SWS_FT_FI3 19) chain A residue 72 type MOD_RES sequence E description N6-acetyllysine; alternate => ECO:0000269|PubMed:10656795 source Swiss-Prot : SWS_FT_FI3 20) chain A residue 61-73 type prosite sequence DEDGDGECDFQEF description EF_HAND_1 EF-hand calcium-binding domain. DEDGDGECDfqEF source prosite : PS00018 21) chain A residue 56-77 type prosite sequence VMETLDEDGDGECDFQEFMAFV description S100_CABP S-100/ICaBP type calcium binding protein signature. VMetLDedgDgecDFqEFmaFV source prosite : PS00303

Display surface Download Links