eF-site ID 1dss-R PDB Code 1dss Chain R click to enlarge Title STRUCTURE OF ACTIVE-SITE CARBOXYMETHYLATED D-GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE FROM PALINURUS VERSICOLOR Classification ACTIVE-SITE CARBOXYMETHYLATION Compound D-GLYCERALDEHYDE-3-PHOSPHATE-DEHYDROGENASE Source ORGANISM_COMMON: South China Sea lobster; ORGANISM_SCIENTIFIC: Palinurus versicolor; Sequence R:  SKIGINGFGRIGRLVLRAALEMGAQVVAVNDPFIALEYMV YMFKYDSTHGMFKGEVKAEDGALVVDGKKITVFNEMKPEN IPWSKAGAEYIVESTGVFTTIEKASAHFKGGAKKVIISAP SADAPMFVCGVNLEKYSKDMKVVSNASXTTNCLAPVAKVL HENFEIVEGLMTTVHAVTATQKTVDGPSAKDWRGGRGAAQ NIIPSSTGAAKAVGKVIPELDGKLTGMAFRVPTPNVSVVD LTVRLGKECSYDDIKAAMKAASEGPLQGVLGYTEDDVVSC DFTGDNRSSIFDAKAGIQLSKTFVKVVSWYDNEFGYSQRV IDLIKHMQKVDSA Description Functional site 1) chain R residue 149 type sequence X description ACTIVE SITE. source : AVR 2) chain R residue 176 type sequence H description ACTIVE SITE. source : AVR 3) chain R residue 148 type sequence S description BINDING SITE FOR RESIDUE SO4 R 501 source : AC3 4) chain R residue 149 type sequence X description BINDING SITE FOR RESIDUE SO4 R 501 source : AC3 5) chain R residue 150 type sequence T description BINDING SITE FOR RESIDUE SO4 R 501 source : AC3 6) chain R residue 176 type sequence H description BINDING SITE FOR RESIDUE SO4 R 501 source : AC3 7) chain R residue 208 type sequence T description BINDING SITE FOR RESIDUE SO4 R 501 source : AC3 8) chain R residue 209 type sequence G description BINDING SITE FOR RESIDUE SO4 R 501 source : AC3 9) chain R residue 149 type sequence X description BINDING SITE FOR RESIDUE SO4 R 502 source : AC4 10) chain R residue 179 type sequence T description BINDING SITE FOR RESIDUE SO4 R 502 source : AC4 11) chain R residue 181 type sequence T description BINDING SITE FOR RESIDUE SO4 R 502 source : AC4 12) chain R residue 231 type sequence R description BINDING SITE FOR RESIDUE SO4 R 502 source : AC4 13) chain R residue 6 type sequence N description BINDING SITE FOR RESIDUE NAD R 335 source : AC6 14) chain R residue 7 type sequence G description BINDING SITE FOR RESIDUE NAD R 335 source : AC6 15) chain R residue 9 type sequence G description BINDING SITE FOR RESIDUE NAD R 335 source : AC6 16) chain R residue 10 type sequence R description BINDING SITE FOR RESIDUE NAD R 335 source : AC6 17) chain R residue 11 type sequence I description BINDING SITE FOR RESIDUE NAD R 335 source : AC6 18) chain R residue 31 type sequence N description BINDING SITE FOR RESIDUE NAD R 335 source : AC6 19) chain R residue 32 type sequence D description BINDING SITE FOR RESIDUE NAD R 335 source : AC6 20) chain R residue 33 type sequence P description BINDING SITE FOR RESIDUE NAD R 335 source : AC6 21) chain R residue 34 type sequence F description BINDING SITE FOR RESIDUE NAD R 335 source : AC6 22) chain R residue 76 type sequence E description BINDING SITE FOR RESIDUE NAD R 335 source : AC6 23) chain R residue 77 type sequence M description BINDING SITE FOR RESIDUE NAD R 335 source : AC6 24) chain R residue 95 type sequence S description BINDING SITE FOR RESIDUE NAD R 335 source : AC6 25) chain R residue 96 type sequence T description BINDING SITE FOR RESIDUE NAD R 335 source : AC6 26) chain R residue 97 type sequence G description BINDING SITE FOR RESIDUE NAD R 335 source : AC6 27) chain R residue 99 type sequence F description BINDING SITE FOR RESIDUE NAD R 335 source : AC6 28) chain R residue 119 type sequence S description BINDING SITE FOR RESIDUE NAD R 335 source : AC6 29) chain R residue 120 type sequence A description BINDING SITE FOR RESIDUE NAD R 335 source : AC6 30) chain R residue 149 type sequence X description BINDING SITE FOR RESIDUE NAD R 335 source : AC6 31) chain R residue 180 type sequence A description BINDING SITE FOR RESIDUE NAD R 335 source : AC6 32) chain R residue 313 type sequence N description BINDING SITE FOR RESIDUE NAD R 335 source : AC6 33) chain R residue 314 type sequence E description BINDING SITE FOR RESIDUE NAD R 335 source : AC6 34) chain R residue 317 type sequence Y description BINDING SITE FOR RESIDUE NAD R 335 source : AC6 35) chain R residue 149 type catalytic sequence X description 911 source MCSA : MCSA2 36) chain R residue 176 type catalytic sequence H description 911 source MCSA : MCSA2 37) chain R residue 149 type ACT_SITE sequence X description Nucleophile source Swiss-Prot : SWS_FT_FI1 38) chain R residue 231 type BINDING sequence R description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI3 39) chain R residue 77 type BINDING sequence M description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI3 40) chain R residue 148 type BINDING sequence S description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI3 41) chain R residue 179 type BINDING sequence T description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI3 42) chain R residue 208 type BINDING sequence T description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI3 43) chain R residue 176 type SITE sequence H description Activates thiol group during catalysis source Swiss-Prot : SWS_FT_FI4 44) chain R residue 1 type MOD_RES sequence S description N-acetylserine => ECO:0000250|UniProtKB:P00357 source Swiss-Prot : SWS_FT_FI5 45) chain R residue 10 type BINDING sequence R description BINDING => ECO:0000269|PubMed:9761850 source Swiss-Prot : SWS_FT_FI2 46) chain R residue 32 type BINDING sequence D description BINDING => ECO:0000269|PubMed:9761850 source Swiss-Prot : SWS_FT_FI2 47) chain R residue 313 type BINDING sequence N description BINDING => ECO:0000269|PubMed:9761850 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links