eF-site ID 1doa-AB PDB Code 1doa Chain A, B click to enlarge Title Structure of the rho family gtp-binding protein cdc42 in complex with the multifunctional regulator rhogdi Classification CELL CYCLE Compound PROTEIN (GTP-BINDING PROTEIN) Source Homo sapiens (Human) (GDIR_BOVIN) Sequence A:  GSHMQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVF DNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDV FLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQI DLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVEC SALTQKGLKNVFDEAILAALEPPEPKKSRRX B:  EPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKD DESLRKYKEALLGRVAVSADPNVPNVVVTRLTLVCSTAPG PLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVS GMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPMEE APKGMLARGSYNIKSRFTDDDRTDHLSWEWNLTIKKEWKD Description (1)  GTP-BINDING PROTEIN/GDP-DISSOCIATION INHIBITOR 1 Functional site 1) chain A residue 17 type sequence T description BINDING SITE FOR RESIDUE MG A 199 source : AC1 2) chain A residue 35 type sequence T description BINDING SITE FOR RESIDUE MG A 199 source : AC1 3) chain A residue 57 type sequence D description BINDING SITE FOR RESIDUE MG A 199 source : AC1 4) chain A residue 0 type sequence H description BINDING SITE FOR RESIDUE MG A 200 source : AC2 5) chain A residue 0 type sequence H description BINDING SITE FOR RESIDUE MG A 200 source : AC2 6) chain A residue 0 type sequence H description BINDING SITE FOR RESIDUE MG A 200 source : AC2 7) chain A residue 12 type sequence G description BINDING SITE FOR RESIDUE GDP A 198 source : AC3 8) chain A residue 13 type sequence A description BINDING SITE FOR RESIDUE GDP A 198 source : AC3 9) chain A residue 14 type sequence V description BINDING SITE FOR RESIDUE GDP A 198 source : AC3 10) chain A residue 15 type sequence G description BINDING SITE FOR RESIDUE GDP A 198 source : AC3 11) chain A residue 16 type sequence K description BINDING SITE FOR RESIDUE GDP A 198 source : AC3 12) chain A residue 17 type sequence T description BINDING SITE FOR RESIDUE GDP A 198 source : AC3 13) chain A residue 18 type sequence C description BINDING SITE FOR RESIDUE GDP A 198 source : AC3 14) chain A residue 28 type sequence F description BINDING SITE FOR RESIDUE GDP A 198 source : AC3 15) chain A residue 33 type sequence V description BINDING SITE FOR RESIDUE GDP A 198 source : AC3 16) chain A residue 116 type sequence Q description BINDING SITE FOR RESIDUE GDP A 198 source : AC3 17) chain A residue 118 type sequence D description BINDING SITE FOR RESIDUE GDP A 198 source : AC3 18) chain A residue 158 type sequence S description BINDING SITE FOR RESIDUE GDP A 198 source : AC3 19) chain A residue 159 type sequence A description BINDING SITE FOR RESIDUE GDP A 198 source : AC3 20) chain A residue 160 type sequence L description BINDING SITE FOR RESIDUE GDP A 198 source : AC3 21) chain A residue 186 type sequence R description BINDING SITE FOR RESIDUE GER A 952 source : AC4 22) chain A residue 188 type sequence X description BINDING SITE FOR RESIDUE GER A 952 source : AC4 23) chain B residue 14 type sequence I description BINDING SITE FOR RESIDUE GER A 952 source : AC4 24) chain B residue 75 type sequence L description BINDING SITE FOR RESIDUE GER A 952 source : AC4 25) chain B residue 110 type sequence Y description BINDING SITE FOR RESIDUE GER A 952 source : AC4 26) chain B residue 130 type sequence Q description BINDING SITE FOR RESIDUE GER A 952 source : AC4 27) chain B residue 132 type sequence T description BINDING SITE FOR RESIDUE GER A 952 source : AC4 28) chain B residue 140 type sequence D description BINDING SITE FOR RESIDUE GER A 952 source : AC4 29) chain B residue 171 type sequence A description BINDING SITE FOR RESIDUE GER A 952 source : AC4 30) chain B residue 194 type sequence W description BINDING SITE FOR RESIDUE GER A 952 source : AC4 31) chain B residue 196 type sequence L description BINDING SITE FOR RESIDUE GER A 952 source : AC4 32) chain A residue 115 type MOD_RES sequence T description N-acetylalanine => ECO:0000250|UniProtKB:P52565 source Swiss-Prot : SWS_FT_FI1 33) chain B residue 115 type MOD_RES sequence S description Phosphoserine; by PKC => ECO:0000255 source Swiss-Prot : SWS_FT_FI7 34) chain B residue 138 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate => ECO:0000250|UniProtKB:P52565 source Swiss-Prot : SWS_FT_FI9 35) chain B residue 141 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate => ECO:0000250|UniProtKB:P52565 source Swiss-Prot : SWS_FT_FI9 36) chain B residue 105 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P52565 source Swiss-Prot : SWS_FT_FI6 37) chain B residue 127 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P52565 source Swiss-Prot : SWS_FT_FI6 38) chain B residue 178 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P52565 source Swiss-Prot : SWS_FT_FI6 39) chain B residue 141 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:Q99PT1 source Swiss-Prot : SWS_FT_FI8 40) chain B residue 34 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:Q99PT1 source Swiss-Prot : SWS_FT_FI2 41) chain B residue 43 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:Q99PT1 source Swiss-Prot : SWS_FT_FI3 42) chain B residue 47 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P52565 source Swiss-Prot : SWS_FT_FI4 43) chain B residue 101 type MOD_RES sequence S description Phosphoserine; by PKA => ECO:0000255 source Swiss-Prot : SWS_FT_FI5

Display surface Download Links