eF-site ID 1do7-A
PDB Code 1do7
Chain A

click to enlarge
Title CARBONMONOXY-MYOGLOBIN (MUTANT L29W) REBINDING STRUCTURE AFTER PHOTOLYSIS AT T< 180K
Classification OXYGEN STORAGE/TRANSPORT
Compound MYOGLOBIN
Source Physeter catodon (Sperm whale) (Physeter macrocephalus) (MYG_PHYCA)
Sequence A:  VLSEGEWQLVLHVWAKVEADVAGHGQDIWIRLFKSHPETL
EKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKG
HHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHP
GNFGADAQGAMNKALELFRKDIAAKYKELGYQG
Description (1)  MYOGLOBIN


Functional site

1) chain A
residue 101
type
ligand
sequence I
description BINDING SITE FOR RESIDUE GLC A 344
source : AC1

2) chain A
residue 105
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GLC A 344
source : AC1

3) chain A
residue 136
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GLC A 344
source : AC1

4) chain A
residue 139
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GLC A 344
source : AC1

5) chain A
residue 105
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GLC A 345
source : AC2

6) chain A
residue 136
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GLC A 345
source : AC2

7) chain A
residue 150
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GLC A 345
source : AC2

8) chain A
residue 152
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE GLC A 345
source : AC2

9) chain A
residue 3
type
ligand
sequence S
description BINDING SITE FOR RESIDUE SO4 A 342
source : AC3

10) chain A
residue 4
type
ligand
sequence E
description BINDING SITE FOR RESIDUE SO4 A 342
source : AC3

11) chain A
residue 34
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SO4 A 342
source : AC3

12) chain A
residue 51
type
ligand
sequence T
description BINDING SITE FOR RESIDUE SO4 A 342
source : AC3

13) chain A
residue 52
type
ligand
sequence E
description BINDING SITE FOR RESIDUE SO4 A 342
source : AC3

14) chain A
residue 53
type
ligand
sequence A
description BINDING SITE FOR RESIDUE SO4 A 342
source : AC3

15) chain A
residue 124
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SO4 A 343
source : AC4

16) chain A
residue 125
type
ligand
sequence A
description BINDING SITE FOR RESIDUE SO4 A 343
source : AC4

17) chain A
residue 126
type
ligand
sequence D
description BINDING SITE FOR RESIDUE SO4 A 343
source : AC4

18) chain A
residue 39
type
ligand
sequence T
description BINDING SITE FOR RESIDUE HEM A 154
source : AC5

19) chain A
residue 42
type
ligand
sequence K
description BINDING SITE FOR RESIDUE HEM A 154
source : AC5

20) chain A
residue 43
type
ligand
sequence F
description BINDING SITE FOR RESIDUE HEM A 154
source : AC5

21) chain A
residue 45
type
ligand
sequence R
description BINDING SITE FOR RESIDUE HEM A 154
source : AC5

22) chain A
residue 64
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM A 154
source : AC5

23) chain A
residue 89
type
ligand
sequence L
description BINDING SITE FOR RESIDUE HEM A 154
source : AC5

24) chain A
residue 92
type
ligand
sequence S
description BINDING SITE FOR RESIDUE HEM A 154
source : AC5

25) chain A
residue 93
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM A 154
source : AC5

26) chain A
residue 97
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM A 154
source : AC5

27) chain A
residue 99
type
ligand
sequence I
description BINDING SITE FOR RESIDUE HEM A 154
source : AC5

28) chain A
residue 103
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE HEM A 154
source : AC5

29) chain A
residue 104
type
ligand
sequence L
description BINDING SITE FOR RESIDUE HEM A 154
source : AC5

30) chain A
residue 29
type
ligand
sequence W
description BINDING SITE FOR RESIDUE CMO A 155
source : AC6

31) chain A
residue 43
type
ligand
sequence F
description BINDING SITE FOR RESIDUE CMO A 155
source : AC6

32) chain A
residue 64
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CMO A 155
source : AC6

33) chain A
residue 68
type
ligand
sequence V
description BINDING SITE FOR RESIDUE CMO A 155
source : AC6

34) chain A
residue 65
type METAL
ligand
sequence G
description Iron (heme distal ligand). {ECO:0000255|PROSITE-ProRule:PRU00238, ECO:0000269|PubMed:845959}
source Swiss-Prot : SWS_FT_FI1

35) chain A
residue 94
type METAL
ligand
sequence A
description Iron (heme proximal ligand). {ECO:0000255|PROSITE-ProRule:PRU00238, ECO:0000269|PubMed:845959}
source Swiss-Prot : SWS_FT_FI2

36) chain A
residue 32
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence L
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1do7_A_154

37) chain A
residue 39
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence T
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1do7_A_154

38) chain A
residue 42-43
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence KF
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1do7_A_154

39) chain A
residue 45-46
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence RF
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1do7_A_154

40) chain A
residue 64
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence H
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1do7_A_154

41) chain A
residue 67-68
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence TV
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1do7_A_154

42) chain A
residue 71-72
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence AL
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1do7_A_154

43) chain A
residue 75
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence I
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1do7_A_154

44) chain A
residue 88-89
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence PL
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1do7_A_154

45) chain A
residue 92-93
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence SH
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1do7_A_154

46) chain A
residue 97
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence H
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1do7_A_154

47) chain A
residue 99
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence I
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1do7_A_154

48) chain A
residue 103-104
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence YL
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1do7_A_154

49) chain A
residue 107
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence I
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1do7_A_154

50) chain A
residue 111
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence I
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1do7_A_154

51) chain A
residue 138
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence F
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1do7_A_154

52) chain A
residue 101
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence I
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1do7_A_344

53) chain A
residue 105
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence E
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1do7_A_344

54) chain A
residue 136
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence E
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1do7_A_344

55) chain A
residue 139
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence R
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1do7_A_344

56) chain A
residue 105
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence E
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1do7_A_345

57) chain A
residue 132
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence N
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1do7_A_345

58) chain A
residue 136
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence E
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1do7_A_345

59) chain A
residue 139
type binding
ligand GLC: ALPHA-D-GLUCOSE
sequence R
description ALPHA-D-GLUCOSE binding site
source pdb_hetatom : GLC_1do7_A_345


Display surface

Download
Links