eF-site ID 1do7-A
PDB Code 1do7
Chain A

click to enlarge
Title CARBONMONOXY-MYOGLOBIN (MUTANT L29W) REBINDING STRUCTURE AFTER PHOTOLYSIS AT T< 180K
Classification OXYGEN STORAGE/TRANSPORT
Compound MYOGLOBIN
Source Physeter catodon (Sperm whale) (Physeter macrocephalus) (MYG_PHYCA)
Sequence A:  VLSEGEWQLVLHVWAKVEADVAGHGQDIWIRLFKSHPETL
EKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKG
HHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHP
GNFGADAQGAMNKALELFRKDIAAKYKELGYQG
Description (1)  MYOGLOBIN


Functional site

1) chain A
residue 65
type METAL
ligand
sequence G
description Iron (heme distal ligand). {ECO:0000255|PROSITE-ProRule:PRU00238, ECO:0000269|PubMed:845959}
source Swiss-Prot : SWS_FT_FI1

2) chain A
residue 94
type METAL
ligand
sequence A
description Iron (heme proximal ligand). {ECO:0000255|PROSITE-ProRule:PRU00238, ECO:0000269|PubMed:845959}
source Swiss-Prot : SWS_FT_FI2


Display surface

Download
Links