eF-site ID 1djy-A PDB Code 1djy Chain A click to enlarge Title PHOSPHOINOSITIDE-SPECIFIC PHOSPHOLIPASE C-DELTA1 FROM RAT COMPLEXED WITH INOSITOL-2,4,5-TRISPHOSPHATE Classification LIPID DEGRADATION Compound PHOSPHOINOSITIDE-SPECIFIC PHOSPHOLIPASE C, ISOZYME DELTA1 Source Rattus norvegicus (Rat) (PLCD1_RAT) Sequence A:  EIETFYKMLTQRAEIDRAFEEAAGSAETLSVERLVTFLQH QQREEEAGPALALSLIERYEPSETAKAQRQMTKDGFLMYL LSADGNAFSLAHRRVYQDMDQPLSHYLVSSSHNTYLLEDQ LTGPSSTEAYIRALCKGCRCLELDCWDGPNQEPIIYHGYT FTSKILFCDVLRAIRDYAFKASPYPVILSLENHCSLEQQR VMARHLRAILGPILLDQPLDGVTTSLPSPEQLKGKILLKG KKLKLVPELSDMIIYCKSVHFGGFSSPGTSGQAFYEMASF SESRALRLLQESGNGFVRHNVSCLSRIYPAGWRTDSSNYS PVEMWNGGCQIVALNFQTPGPEMDVYLGCFQDNGGCGYVL KPAFLRDPNTTFNSRALTQGPWWRPERLRVRIISGQQLPK VNKNKNSIVDPKVIVEIHGVGRDTGSRQTAVITNNGFNPR WDMEFEFEVTVPDLALVRFMVEDYDSSSKNDFIGQSTIPW NSLKQGYRHVHLLSKNGDQHPSATLFVKISIQD Description Functional site 1) chain A residue 312 type sequence N description BINDING SITE FOR RESIDUE CA A 2 source : AC1 2) chain A residue 341 type sequence E description BINDING SITE FOR RESIDUE CA A 2 source : AC1 3) chain A residue 343 type sequence D description BINDING SITE FOR RESIDUE CA A 2 source : AC1 4) chain A residue 390 type sequence E description BINDING SITE FOR RESIDUE CA A 2 source : AC1 5) chain A residue 651 type sequence I description BINDING SITE FOR RESIDUE CA A 3 source : AC2 6) chain A residue 653 type sequence D description BINDING SITE FOR RESIDUE CA A 3 source : AC2 7) chain A residue 677 type sequence N description BINDING SITE FOR RESIDUE CA A 3 source : AC2 8) chain A residue 653 type sequence D description BINDING SITE FOR RESIDUE CA A 4 source : AC3 9) chain A residue 706 type sequence D description BINDING SITE FOR RESIDUE CA A 4 source : AC3 10) chain A residue 707 type sequence Y description BINDING SITE FOR RESIDUE CA A 4 source : AC3 11) chain A residue 583 type sequence G description BINDING SITE FOR RESIDUE ACT A 5 source : AC4 12) chain A residue 584 type sequence P description BINDING SITE FOR RESIDUE ACT A 5 source : AC4 13) chain A residue 587 type sequence D description BINDING SITE FOR RESIDUE ACT A 5 source : AC4 14) chain A residue 701 type sequence R description BINDING SITE FOR RESIDUE ACT A 5 source : AC4 15) chain A residue 715 type sequence F description BINDING SITE FOR RESIDUE ACT A 5 source : AC4 16) chain A residue 311 type sequence H description BINDING SITE FOR RESIDUE I2P A 1 source : AC9 17) chain A residue 312 type sequence N description BINDING SITE FOR RESIDUE I2P A 1 source : AC9 18) chain A residue 341 type sequence E description BINDING SITE FOR RESIDUE I2P A 1 source : AC9 19) chain A residue 343 type sequence D description BINDING SITE FOR RESIDUE I2P A 1 source : AC9 20) chain A residue 356 type sequence H description BINDING SITE FOR RESIDUE I2P A 1 source : AC9 21) chain A residue 390 type sequence E description BINDING SITE FOR RESIDUE I2P A 1 source : AC9 22) chain A residue 438 type sequence K description BINDING SITE FOR RESIDUE I2P A 1 source : AC9 23) chain A residue 522 type sequence S description BINDING SITE FOR RESIDUE I2P A 1 source : AC9 24) chain A residue 549 type sequence R description BINDING SITE FOR RESIDUE I2P A 1 source : AC9 25) chain A residue 551 type sequence Y description BINDING SITE FOR RESIDUE I2P A 1 source : AC9 26) chain A residue 311 type catalytic sequence H description 28 source MCSA : MCSA1 27) chain A residue 312 type catalytic sequence N description 28 source MCSA : MCSA1 28) chain A residue 341 type catalytic sequence E description 28 source MCSA : MCSA1 29) chain A residue 343 type catalytic sequence D description 28 source MCSA : MCSA1 30) chain A residue 356 type catalytic sequence H description 28 source MCSA : MCSA1 31) chain A residue 390 type catalytic sequence E description 28 source MCSA : MCSA1 32) chain A residue 311 type ACT_SITE sequence H description source Swiss-Prot : SWS_FT_FI1 33) chain A residue 356 type ACT_SITE sequence H description source Swiss-Prot : SWS_FT_FI1 34) chain A residue 200 type BINDING sequence E description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI2 35) chain A residue 312 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI3 36) chain A residue 653 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI3 37) chain A residue 677 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI3 38) chain A residue 706 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI3 39) chain A residue 707 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI3 40) chain A residue 708 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI3 41) chain A residue 341 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI3 42) chain A residue 343 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI3 43) chain A residue 390 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI3 44) chain A residue 438 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI3 45) chain A residue 440 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI3 46) chain A residue 522 type BINDING sequence S description source Swiss-Prot : SWS_FT_FI3 47) chain A residue 549 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI3 48) chain A residue 651 type BINDING sequence I description source Swiss-Prot : SWS_FT_FI3

Display surface Download Links