eF-site ID 1dj7-A PDB Code 1dj7 Chain A click to enlarge Title CRYSTAL STRUCTURE OF FERREDOXIN THIOREDOXIN REDUCTASE Classification ELECTRON TRANSPORT Compound FERREDOXIN THIOREDOXIN REDUCTASE: CATALYTIC CHAIN Source Synechocystis sp. (strain PCC 6803 / Kazusa) (FTRV_SYNY3) Sequence A:  NNKTLAAMKNFAEQYAKRTDTYFCSDLSVTAVVIEGLARH KEELGSPLCPCRHYEDKEAEVKNTFWNCPCVPMRERKECH CMLFLTPDNDFAGDAQDIPMETLEEVKAS Description (1)  FERREDOXIN THIOREDOXIN REDUCTASE: CATALYTIC CHAIN COMPLEXED WITH VARIABLE CHAIN Functional site 1) chain A residue 80 type sequence R description BINDING SITE FOR RESIDUE SO4 B 201 source : AC1 2) chain A residue 55 type sequence C description BINDING SITE FOR RESIDUE SF4 A 120 source : AC2 3) chain A residue 74 type sequence C description BINDING SITE FOR RESIDUE SF4 A 120 source : AC2 4) chain A residue 76 type sequence C description BINDING SITE FOR RESIDUE SF4 A 120 source : AC2 5) chain A residue 79 type sequence M description BINDING SITE FOR RESIDUE SF4 A 120 source : AC2 6) chain A residue 85 type sequence C description BINDING SITE FOR RESIDUE SF4 A 120 source : AC2 7) chain A residue 86 type sequence H description BINDING SITE FOR RESIDUE SF4 A 120 source : AC2 8) chain A residue 87 type sequence C description BINDING SITE FOR RESIDUE SF4 A 120 source : AC2 9) chain A residue 55 type BINDING sequence C description BINDING => ECO:0000269|PubMed:10649999, ECO:0000269|PubMed:17611542 source Swiss-Prot : SWS_FT_FI2 10) chain A residue 74 type BINDING sequence C description BINDING => ECO:0000269|PubMed:10649999, ECO:0000269|PubMed:17611542 source Swiss-Prot : SWS_FT_FI2 11) chain A residue 76 type BINDING sequence C description BINDING => ECO:0000269|PubMed:10649999, ECO:0000269|PubMed:17611542 source Swiss-Prot : SWS_FT_FI2 12) chain A residue 85 type BINDING sequence C description BINDING => ECO:0000269|PubMed:10649999, ECO:0000269|PubMed:17611542 source Swiss-Prot : SWS_FT_FI2 13) chain A residue 57 type ACT_SITE sequence C description Nucleophile => ECO:0000269|PubMed:10649999, ECO:0000269|PubMed:14769790, ECO:0000269|PubMed:17611542, ECO:0000269|PubMed:19132843 source Swiss-Prot : SWS_FT_FI1 14) chain A residue 86 type SITE sequence H description Increases the nucleophilicity of the active site Cys => ECO:0000269|PubMed:19132843 source Swiss-Prot : SWS_FT_FI3 15) chain A residue 55 type catalytic sequence C description 980 source MCSA : MCSA1 16) chain A residue 57 type catalytic sequence C description 980 source MCSA : MCSA1 17) chain A residue 74 type catalytic sequence C description 980 source MCSA : MCSA1 18) chain A residue 76 type catalytic sequence C description 980 source MCSA : MCSA1 19) chain A residue 85 type catalytic sequence C description 980 source MCSA : MCSA1 20) chain A residue 86 type catalytic sequence H description 980 source MCSA : MCSA1 21) chain A residue 87 type catalytic sequence C description 980 source MCSA : MCSA1

Display surface Download Links