eF-site ID 1dix-A PDB Code 1dix Chain A click to enlarge Title CRYSTAL STRUCTURE OF RNASE LE Classification HYDROLASE Compound EXTRACELLULAR RIBONUCLEASE LE Source Solanum lycopersicum (Tomato) (Lycopersicon esculentum) (RNLE_LYCES) Sequence A:  ASGSKDFDFFYFVQQWPGSYCDTKQSCCYPTTGKPAADFG IHGLWPNNNDGTYPSNCDPNSPYDQSQISDLISSMQQNWP TLACPSGSGSTFWSHEWEKHGTCAESVLTNQHAYFKKALD LKNQIDLLSILQGADIHPDGESYDLVNIRNAIKSAIGYTP WIQCNVDQSGNSQLYQVYICVDGSGSSLIECPIFPGGKCG TSIEFPTF Description (1)  EXTRACELLULAR RIBONUCLEASE LE (E.C.3.1.27.1) Functional site 1) chain A residue 93 type ACT_SITE sequence E description ACT_SITE => ECO:0000250|UniProtKB:P08056 source Swiss-Prot : SWS_FT_FI2 2) chain A residue 97 type ACT_SITE sequence H description Proton acceptor => ECO:0000250|UniProtKB:Q7SID5, ECO:0000255|PROSITE-ProRule:PRU10045 source Swiss-Prot : SWS_FT_FI3 3) chain A residue 12 type BINDING sequence Q description BINDING => ECO:0000250|UniProtKB:P23540 source Swiss-Prot : SWS_FT_FI4 4) chain A residue 39 type BINDING sequence H description BINDING => ECO:0000250|UniProtKB:P23540 source Swiss-Prot : SWS_FT_FI4 5) chain A residue 89 type BINDING sequence F description BINDING => ECO:0000250|UniProtKB:P23540 source Swiss-Prot : SWS_FT_FI4 6) chain A residue 92 type BINDING sequence H description BINDING => ECO:0000250|UniProtKB:P23540 source Swiss-Prot : SWS_FT_FI4 7) chain A residue 96 type BINDING sequence K description BINDING => ECO:0000250|UniProtKB:P23540 source Swiss-Prot : SWS_FT_FI4 8) chain A residue 39 type ACT_SITE sequence H description Proton donor => ECO:0000250|UniProtKB:Q7SID5, ECO:0000255|PROSITE-ProRule:PRU10045 source Swiss-Prot : SWS_FT_FI1 9) chain A residue 36-43 type prosite sequence FGIHGLWP description RNASE_T2_1 Ribonuclease T2 family histidine active site 1. FgIHGLWP source prosite : PS00530 10) chain A residue 89-100 type prosite sequence FWSHEWEKHGTC description RNASE_T2_2 Ribonuclease T2 family histidine active site 2. FwsHEWeKHGtC source prosite : PS00531

Display surface Download Links