eF-site ID 1dej-S PDB Code 1dej Chain S click to enlarge Title CRYSTAL STRUCTURE OF A DICTYOSTELIUM/TETRAHYMENA CHIMERA ACTIN (MUTANT 646: Q228K/T229A/A230Y/A231K/S232E/E360H) IN COMPLEX WITH HUMAN GELSOLIN SEGMENT 1 Classification CONTRACTILE PROTEIN Compound GELSOLIN Source (ACT8_DICDI) Sequence S:  MGSVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTCLYGDF FTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAA IFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKK GGVASGF Description Functional site 1) chain S residue 43 type sequence G description BINDING SITE FOR RESIDUE CA S 128 source : AC1 2) chain S residue 44 type sequence D description BINDING SITE FOR RESIDUE CA S 128 source : AC1 3) chain S residue 75 type sequence E description BINDING SITE FOR RESIDUE CA S 128 source : AC1 4) chain S residue 123 type sequence V description BINDING SITE FOR RESIDUE CA S 128 source : AC1 5) chain S residue 87 type sequence D description BINDING SITE FOR RESIDUE CA S 129 source : AC2 6) chain S residue 92 type sequence G description BINDING SITE FOR RESIDUE CA S 129 source : AC2 7) chain S residue 94 type sequence A description BINDING SITE FOR RESIDUE CA S 129 source : AC2 8) chain S residue 37 type MOD_RES sequence Y description Phosphotyrosine; by SRC; in vitro => ECO:0000269|PubMed:10210201 source Swiss-Prot : SWS_FT_FI3 9) chain S residue 44 type MOD_RES sequence D description Phosphotyrosine => ECO:0000269|PubMed:7498488 source Swiss-Prot : SWS_FT_FI1 10) chain S residue 75 type MOD_RES sequence E description Phosphotyrosine => ECO:0000269|PubMed:7498488 source Swiss-Prot : SWS_FT_FI1 11) chain S residue 87 type MOD_RES sequence D description Phosphotyrosine => ECO:0000269|PubMed:7498488 source Swiss-Prot : SWS_FT_FI1 12) chain S residue 92 type MOD_RES sequence G description Phosphotyrosine => ECO:0000269|PubMed:7498488 source Swiss-Prot : SWS_FT_FI1 13) chain S residue 94 type MOD_RES sequence A description Phosphotyrosine => ECO:0000269|PubMed:7498488 source Swiss-Prot : SWS_FT_FI1 14) chain S residue 123 type MOD_RES sequence V description Phosphotyrosine => ECO:0000269|PubMed:7498488 source Swiss-Prot : SWS_FT_FI1 15) chain S residue 113 type BINDING sequence K description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links