eF-site ID 1deh-AB PDB Code 1deh Chain A, B click to enlarge Title CRYSTALLIZATION OF HUMAN BETA1 ALCOHOL DEHYDROGENASE (15 MG/ML) IN 50 MM SODIUM PHOSPHATE (PH 7.5), 2.0 MM NAD+ AND 1 MM 4-IODOPYRAZOLE AT 25 OC, 13% (W/V) PEG 8000 Classification OXIDOREDUCTASE Compound HUMAN BETA1 ALCOHOL DEHYDROGENASE Source Homo sapiens (Human) (ADHB_HUMAN) Sequence A:  STAGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKM VAVGICRTDDHVVSGNLVTPLPVILGHEAAGIVESVGEGV TTVKPGDKVIPLFTPQCGKCRVCKNPESNYCLKNDLGNPR GTLQDGTRRFTCRGKPIHHFLGTSTFSQYTVVDENAVAKI DAASPLEKVCLIGCGFSTGYGSAVNVAKVTPGSTCAVFGL GGVGLSAVMGCKAAGAARIIAVDINKDKFAKAKELGATEC INPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLL CCHEACGTSVIVGVPPASQNLSINPMLLLTGRTWKGAVYG GFKSKEGIPKLVADFMAKKFSLDALITHVLPFEKINEGFD LLHSGKSIRTVLTF B:  STAGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKM VAVGICRTDDHVVSGNLVTPLPVILGHEAAGIVESVGEGV TTVKPGDKVIPLFTPQCGKCRVCKNPESNYCLKNDLGNPR GTLQDGTRRFTCRGKPIHHFLGTSTFSQYTVVDENAVAKI DAASPLEKVCLIGCGFSTGYGSAVNVAKVTPGSTCAVFGL GGVGLSAVMGCKAAGAARIIAVDINKDKFAKAKELGATEC INPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLL CCHEACGTSVIVGVPPASQNLSINPMLLLTGRTWKGAVYG GFKSKEGIPKLVADFMAKKFSLDALITHVLPFEKINEGFD LLHSGKSIRTVLTF Description Functional site 1) chain A residue 97 type sequence C description source : ZA1 2) chain A residue 100 type sequence C description source : ZA1 3) chain A residue 103 type sequence C description source : ZA1 4) chain A residue 111 type sequence C description source : ZA1 5) chain A residue 46 type sequence C description source : ZA2 6) chain A residue 67 type sequence H description source : ZA2 7) chain A residue 174 type sequence C description source : ZA2 8) chain B residue 97 type sequence C description source : ZB1 9) chain B residue 100 type sequence C description source : ZB1 10) chain B residue 103 type sequence C description source : ZB1 11) chain B residue 111 type sequence C description source : ZB1 12) chain B residue 46 type sequence C description source : ZB2 13) chain B residue 67 type sequence H description source : ZB2 14) chain B residue 174 type sequence C description source : ZB2 15) chain A residue 97 type sequence C description BINDING SITE FOR RESIDUE ZN A 375 source : AC1 16) chain A residue 100 type sequence C description BINDING SITE FOR RESIDUE ZN A 375 source : AC1 17) chain A residue 103 type sequence C description BINDING SITE FOR RESIDUE ZN A 375 source : AC1 18) chain A residue 111 type sequence C description BINDING SITE FOR RESIDUE ZN A 375 source : AC1 19) chain A residue 46 type sequence C description BINDING SITE FOR RESIDUE ZN A 376 source : AC2 20) chain A residue 67 type sequence H description BINDING SITE FOR RESIDUE ZN A 376 source : AC2 21) chain A residue 174 type sequence C description BINDING SITE FOR RESIDUE ZN A 376 source : AC2 22) chain B residue 97 type sequence C description BINDING SITE FOR RESIDUE ZN B 375 source : AC3 23) chain B residue 100 type sequence C description BINDING SITE FOR RESIDUE ZN B 375 source : AC3 24) chain B residue 103 type sequence C description BINDING SITE FOR RESIDUE ZN B 375 source : AC3 25) chain B residue 111 type sequence C description BINDING SITE FOR RESIDUE ZN B 375 source : AC3 26) chain B residue 46 type sequence C description BINDING SITE FOR RESIDUE ZN B 376 source : AC4 27) chain B residue 67 type sequence H description BINDING SITE FOR RESIDUE ZN B 376 source : AC4 28) chain B residue 174 type sequence C description BINDING SITE FOR RESIDUE ZN B 376 source : AC4 29) chain B residue 128 type sequence R description BINDING SITE FOR RESIDUE CL B 601 source : AC5 30) chain A residue 46 type sequence C description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 31) chain A residue 47 type sequence R description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 32) chain A residue 48 type sequence T description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 33) chain A residue 51 type sequence H description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 34) chain A residue 93 type sequence F description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 35) chain A residue 174 type sequence C description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 36) chain A residue 178 type sequence T description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 37) chain A residue 199 type sequence G description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 38) chain A residue 201 type sequence G description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 39) chain A residue 202 type sequence G description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 40) chain A residue 203 type sequence V description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 41) chain A residue 223 type sequence D description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 42) chain A residue 224 type sequence I description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 43) chain A residue 228 type sequence K description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 44) chain A residue 268 type sequence V description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 45) chain A residue 269 type sequence I description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 46) chain A residue 271 type sequence R description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 47) chain A residue 292 type sequence V description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 48) chain A residue 294 type sequence V description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 49) chain A residue 317 type sequence A description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 50) chain A residue 318 type sequence V description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 51) chain A residue 319 type sequence Y description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 52) chain A residue 362 type sequence L description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 53) chain A residue 369 type sequence R description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 54) chain A residue 48 type sequence T description BINDING SITE FOR RESIDUE PYZ A 378 source : AC7 55) chain A residue 67 type sequence H description BINDING SITE FOR RESIDUE PYZ A 378 source : AC7 56) chain A residue 93 type sequence F description BINDING SITE FOR RESIDUE PYZ A 378 source : AC7 57) chain A residue 116 type sequence L description BINDING SITE FOR RESIDUE PYZ A 378 source : AC7 58) chain A residue 174 type sequence C description BINDING SITE FOR RESIDUE PYZ A 378 source : AC7 59) chain B residue 46 type sequence C description BINDING SITE FOR RESIDUE NAD B 377 source : AC8 60) chain B residue 47 type sequence R description BINDING SITE FOR RESIDUE NAD B 377 source : AC8 61) chain B residue 48 type sequence T description BINDING SITE FOR RESIDUE NAD B 377 source : AC8 62) chain B residue 51 type sequence H description BINDING SITE FOR RESIDUE NAD B 377 source : AC8 63) chain B residue 174 type sequence C description BINDING SITE FOR RESIDUE NAD B 377 source : AC8 64) chain B residue 178 type sequence T description BINDING SITE FOR RESIDUE NAD B 377 source : AC8 65) chain B residue 199 type sequence G description BINDING SITE FOR RESIDUE NAD B 377 source : AC8 66) chain B residue 200 type sequence L description BINDING SITE FOR RESIDUE NAD B 377 source : AC8 67) chain B residue 201 type sequence G description BINDING SITE FOR RESIDUE NAD B 377 source : AC8 68) chain B residue 202 type sequence G description BINDING SITE FOR RESIDUE NAD B 377 source : AC8 69) chain B residue 203 type sequence V description BINDING SITE FOR RESIDUE NAD B 377 source : AC8 70) chain B residue 223 type sequence D description BINDING SITE FOR RESIDUE NAD B 377 source : AC8 71) chain B residue 228 type sequence K description BINDING SITE FOR RESIDUE NAD B 377 source : AC8 72) chain B residue 268 type sequence V description BINDING SITE FOR RESIDUE NAD B 377 source : AC8 73) chain B residue 269 type sequence I description BINDING SITE FOR RESIDUE NAD B 377 source : AC8 74) chain B residue 271 type sequence R description BINDING SITE FOR RESIDUE NAD B 377 source : AC8 75) chain B residue 292 type sequence V description BINDING SITE FOR RESIDUE NAD B 377 source : AC8 76) chain B residue 293 type sequence G description BINDING SITE FOR RESIDUE NAD B 377 source : AC8 77) chain B residue 294 type sequence V description BINDING SITE FOR RESIDUE NAD B 377 source : AC8 78) chain B residue 317 type sequence A description BINDING SITE FOR RESIDUE NAD B 377 source : AC8 79) chain B residue 318 type sequence V description BINDING SITE FOR RESIDUE NAD B 377 source : AC8 80) chain B residue 319 type sequence Y description BINDING SITE FOR RESIDUE NAD B 377 source : AC8 81) chain B residue 362 type sequence L description BINDING SITE FOR RESIDUE NAD B 377 source : AC8 82) chain B residue 369 type sequence R description BINDING SITE FOR RESIDUE NAD B 377 source : AC8 83) chain B residue 48 type sequence T description BINDING SITE FOR RESIDUE PYZ B 378 source : AC9 84) chain B residue 67 type sequence H description BINDING SITE FOR RESIDUE PYZ B 378 source : AC9 85) chain B residue 93 type sequence F description BINDING SITE FOR RESIDUE PYZ B 378 source : AC9 86) chain B residue 116 type sequence L description BINDING SITE FOR RESIDUE PYZ B 378 source : AC9 87) chain B residue 141 type sequence L description BINDING SITE FOR RESIDUE PYZ B 378 source : AC9 88) chain B residue 174 type sequence C description BINDING SITE FOR RESIDUE PYZ B 378 source : AC9 89) chain A residue 47 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI1 90) chain A residue 229 type BINDING sequence F description source Swiss-Prot : SWS_FT_FI1 91) chain A residue 293 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI1 92) chain A residue 370 type BINDING sequence T description source Swiss-Prot : SWS_FT_FI1 93) chain B residue 47 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI1 94) chain B residue 68 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 95) chain B residue 98 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI1 96) chain B residue 101 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI1 97) chain B residue 104 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI1 98) chain B residue 112 type BINDING sequence L description source Swiss-Prot : SWS_FT_FI1 99) chain B residue 175 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI1 100) chain A residue 68 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 101) chain B residue 200 type BINDING sequence L description source Swiss-Prot : SWS_FT_FI1 102) chain B residue 224 type BINDING sequence I description source Swiss-Prot : SWS_FT_FI1 103) chain B residue 229 type BINDING sequence F description source Swiss-Prot : SWS_FT_FI1 104) chain B residue 293 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI1 105) chain B residue 370 type BINDING sequence T description source Swiss-Prot : SWS_FT_FI1 106) chain A residue 98 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI1 107) chain A residue 101 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI1 108) chain A residue 104 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI1 109) chain A residue 112 type BINDING sequence L description source Swiss-Prot : SWS_FT_FI1 110) chain A residue 175 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI1 111) chain A residue 200 type BINDING sequence L description source Swiss-Prot : SWS_FT_FI1 112) chain A residue 224 type BINDING sequence I description source Swiss-Prot : SWS_FT_FI1 113) chain A residue 2 type MOD_RES sequence T description N-acetylserine => ECO:0000269|PubMed:6391920 source Swiss-Prot : SWS_FT_FI2 114) chain B residue 2 type MOD_RES sequence T description N-acetylserine => ECO:0000269|PubMed:6391920 source Swiss-Prot : SWS_FT_FI2 115) chain A residue 23 type MOD_RES sequence I description Phosphoserine => ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI3 116) chain B residue 23 type MOD_RES sequence I description Phosphoserine => ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI3 117) chain A residue 35 type MOD_RES sequence E description Phosphotyrosine => ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI4 118) chain B residue 35 type MOD_RES sequence E description Phosphotyrosine => ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI4 119) chain A residue 66-80 type prosite sequence GHEAAGIVESVGEGV description ADH_ZINC Zinc-containing alcohol dehydrogenases signature. GHEaAGIvesvGegV source prosite : PS00059

Display surface Download Links