eF-site ID 1deh-A PDB Code 1deh Chain A click to enlarge Title CRYSTALLIZATION OF HUMAN BETA1 ALCOHOL DEHYDROGENASE (15 MG/ML) IN 50 MM SODIUM PHOSPHATE (PH 7.5), 2.0 MM NAD+ AND 1 MM 4-IODOPYRAZOLE AT 25 OC, 13% (W/V) PEG 8000 Classification OXIDOREDUCTASE Compound HUMAN BETA1 ALCOHOL DEHYDROGENASE Source Homo sapiens (Human) (ADHB_HUMAN) Sequence A:  STAGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKM VAVGICRTDDHVVSGNLVTPLPVILGHEAAGIVESVGEGV TTVKPGDKVIPLFTPQCGKCRVCKNPESNYCLKNDLGNPR GTLQDGTRRFTCRGKPIHHFLGTSTFSQYTVVDENAVAKI DAASPLEKVCLIGCGFSTGYGSAVNVAKVTPGSTCAVFGL GGVGLSAVMGCKAAGAARIIAVDINKDKFAKAKELGATEC INPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLL CCHEACGTSVIVGVPPASQNLSINPMLLLTGRTWKGAVYG GFKSKEGIPKLVADFMAKKFSLDALITHVLPFEKINEGFD LLHSGKSIRTVLTF Description Functional site 1) chain A residue 97 type sequence C description source : ZA1 2) chain A residue 100 type sequence C description source : ZA1 3) chain A residue 103 type sequence C description source : ZA1 4) chain A residue 111 type sequence C description source : ZA1 5) chain A residue 46 type sequence C description source : ZA2 6) chain A residue 67 type sequence H description source : ZA2 7) chain A residue 174 type sequence C description source : ZA2 8) chain A residue 97 type sequence C description BINDING SITE FOR RESIDUE ZN A 375 source : AC1 9) chain A residue 100 type sequence C description BINDING SITE FOR RESIDUE ZN A 375 source : AC1 10) chain A residue 103 type sequence C description BINDING SITE FOR RESIDUE ZN A 375 source : AC1 11) chain A residue 111 type sequence C description BINDING SITE FOR RESIDUE ZN A 375 source : AC1 12) chain A residue 46 type sequence C description BINDING SITE FOR RESIDUE ZN A 376 source : AC2 13) chain A residue 67 type sequence H description BINDING SITE FOR RESIDUE ZN A 376 source : AC2 14) chain A residue 174 type sequence C description BINDING SITE FOR RESIDUE ZN A 376 source : AC2 15) chain A residue 46 type sequence C description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 16) chain A residue 47 type sequence R description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 17) chain A residue 48 type sequence T description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 18) chain A residue 51 type sequence H description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 19) chain A residue 93 type sequence F description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 20) chain A residue 174 type sequence C description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 21) chain A residue 178 type sequence T description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 22) chain A residue 199 type sequence G description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 23) chain A residue 201 type sequence G description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 24) chain A residue 202 type sequence G description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 25) chain A residue 203 type sequence V description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 26) chain A residue 223 type sequence D description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 27) chain A residue 224 type sequence I description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 28) chain A residue 228 type sequence K description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 29) chain A residue 268 type sequence V description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 30) chain A residue 269 type sequence I description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 31) chain A residue 271 type sequence R description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 32) chain A residue 292 type sequence V description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 33) chain A residue 294 type sequence V description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 34) chain A residue 317 type sequence A description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 35) chain A residue 318 type sequence V description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 36) chain A residue 319 type sequence Y description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 37) chain A residue 362 type sequence L description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 38) chain A residue 369 type sequence R description BINDING SITE FOR RESIDUE NAD A 377 source : AC6 39) chain A residue 48 type sequence T description BINDING SITE FOR RESIDUE PYZ A 378 source : AC7 40) chain A residue 67 type sequence H description BINDING SITE FOR RESIDUE PYZ A 378 source : AC7 41) chain A residue 93 type sequence F description BINDING SITE FOR RESIDUE PYZ A 378 source : AC7 42) chain A residue 116 type sequence L description BINDING SITE FOR RESIDUE PYZ A 378 source : AC7 43) chain A residue 174 type sequence C description BINDING SITE FOR RESIDUE PYZ A 378 source : AC7 44) chain A residue 66-80 type prosite sequence GHEAAGIVESVGEGV description ADH_ZINC Zinc-containing alcohol dehydrogenases signature. GHEaAGIvesvGegV source prosite : PS00059 45) chain A residue 47 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI1 46) chain A residue 229 type BINDING sequence F description source Swiss-Prot : SWS_FT_FI1 47) chain A residue 293 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI1 48) chain A residue 370 type BINDING sequence T description source Swiss-Prot : SWS_FT_FI1 49) chain A residue 68 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 50) chain A residue 98 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI1 51) chain A residue 101 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI1 52) chain A residue 104 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI1 53) chain A residue 112 type BINDING sequence L description source Swiss-Prot : SWS_FT_FI1 54) chain A residue 175 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI1 55) chain A residue 200 type BINDING sequence L description source Swiss-Prot : SWS_FT_FI1 56) chain A residue 224 type BINDING sequence I description source Swiss-Prot : SWS_FT_FI1 57) chain A residue 2 type MOD_RES sequence T description N-acetylserine => ECO:0000269|PubMed:6391920 source Swiss-Prot : SWS_FT_FI2 58) chain A residue 23 type MOD_RES sequence I description Phosphoserine => ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI3 59) chain A residue 35 type MOD_RES sequence E description Phosphotyrosine => ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links