eF-site ID 1d3h-A PDB Code 1d3h Chain A click to enlarge Title HUMAN DIHYDROOROTATE DEHYDROGENASE COMPLEXED WITH ANTIPROLIFERATIVE AGENT A771726 Classification OXIDOREDUCTASE Compound DIHYDROOROTATE DEHYDROGENASE Source null (PYRD_HUMAN) Sequence A:  MATGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLP FQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMG FGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSH GLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAA EDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRR LLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVV KELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDL STQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASL VQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGA DHRR Description Functional site 1) chain A residue 245 type sequence R description BINDING SITE FOR RESIDUE SO4 A 400 source : AC1 2) chain A residue 247 type sequence V description BINDING SITE FOR RESIDUE SO4 A 400 source : AC1 3) chain A residue 248 type sequence H description BINDING SITE FOR RESIDUE SO4 A 400 source : AC1 4) chain A residue 307 type sequence K description BINDING SITE FOR RESIDUE ACT A 401 source : AC2 5) chain A residue 308 type sequence P description BINDING SITE FOR RESIDUE ACT A 401 source : AC2 6) chain A residue 311 type sequence D description BINDING SITE FOR RESIDUE ACT A 401 source : AC2 7) chain A residue 314 type sequence T description BINDING SITE FOR RESIDUE ACT A 401 source : AC2 8) chain A residue 315 type sequence Q description BINDING SITE FOR RESIDUE ACT A 401 source : AC2 9) chain A residue 318 type sequence R description BINDING SITE FOR RESIDUE ACT A 401 source : AC2 10) chain A residue 43 type sequence M description BINDING SITE FOR RESIDUE A26 A 397 source : AC3 11) chain A residue 52 type sequence P description BINDING SITE FOR RESIDUE A26 A 397 source : AC3 12) chain A residue 56 type sequence H description BINDING SITE FOR RESIDUE A26 A 397 source : AC3 13) chain A residue 59 type sequence A description BINDING SITE FOR RESIDUE A26 A 397 source : AC3 14) chain A residue 98 type sequence F description BINDING SITE FOR RESIDUE A26 A 397 source : AC3 15) chain A residue 136 type sequence R description BINDING SITE FOR RESIDUE A26 A 397 source : AC3 16) chain A residue 356 type sequence Y description BINDING SITE FOR RESIDUE A26 A 397 source : AC3 17) chain A residue 359 type sequence L description BINDING SITE FOR RESIDUE A26 A 397 source : AC3 18) chain A residue 360 type sequence T description BINDING SITE FOR RESIDUE A26 A 397 source : AC3 19) chain A residue 363 type sequence G description BINDING SITE FOR RESIDUE A26 A 397 source : AC3 20) chain A residue 364 type sequence P description BINDING SITE FOR RESIDUE A26 A 397 source : AC3 21) chain A residue 95 type sequence A description BINDING SITE FOR RESIDUE FMN A 398 source : AC4 22) chain A residue 96 type sequence A description BINDING SITE FOR RESIDUE FMN A 398 source : AC4 23) chain A residue 97 type sequence G description BINDING SITE FOR RESIDUE FMN A 398 source : AC4 24) chain A residue 100 type sequence K description BINDING SITE FOR RESIDUE FMN A 398 source : AC4 25) chain A residue 119 type sequence G description BINDING SITE FOR RESIDUE FMN A 398 source : AC4 26) chain A residue 120 type sequence S description BINDING SITE FOR RESIDUE FMN A 398 source : AC4 27) chain A residue 145 type sequence N description BINDING SITE FOR RESIDUE FMN A 398 source : AC4 28) chain A residue 181 type sequence N description BINDING SITE FOR RESIDUE FMN A 398 source : AC4 29) chain A residue 212 type sequence N description BINDING SITE FOR RESIDUE FMN A 398 source : AC4 30) chain A residue 255 type sequence K description BINDING SITE FOR RESIDUE FMN A 398 source : AC4 31) chain A residue 283 type sequence T description BINDING SITE FOR RESIDUE FMN A 398 source : AC4 32) chain A residue 284 type sequence N description BINDING SITE FOR RESIDUE FMN A 398 source : AC4 33) chain A residue 285 type sequence T description BINDING SITE FOR RESIDUE FMN A 398 source : AC4 34) chain A residue 305 type sequence S description BINDING SITE FOR RESIDUE FMN A 398 source : AC4 35) chain A residue 306 type sequence G description BINDING SITE FOR RESIDUE FMN A 398 source : AC4 36) chain A residue 309 type sequence L description BINDING SITE FOR RESIDUE FMN A 398 source : AC4 37) chain A residue 333 type sequence V description BINDING SITE FOR RESIDUE FMN A 398 source : AC4 38) chain A residue 334 type sequence G description BINDING SITE FOR RESIDUE FMN A 398 source : AC4 39) chain A residue 335 type sequence G description BINDING SITE FOR RESIDUE FMN A 398 source : AC4 40) chain A residue 355 type sequence L description BINDING SITE FOR RESIDUE FMN A 398 source : AC4 41) chain A residue 356 type sequence Y description BINDING SITE FOR RESIDUE FMN A 398 source : AC4 42) chain A residue 357 type sequence T description BINDING SITE FOR RESIDUE FMN A 398 source : AC4 43) chain A residue 100 type sequence K description BINDING SITE FOR RESIDUE ORO A 399 source : AC5 44) chain A residue 145 type sequence N description BINDING SITE FOR RESIDUE ORO A 399 source : AC5 45) chain A residue 147 type sequence Y description BINDING SITE FOR RESIDUE ORO A 399 source : AC5 46) chain A residue 148 type sequence G description BINDING SITE FOR RESIDUE ORO A 399 source : AC5 47) chain A residue 149 type sequence F description BINDING SITE FOR RESIDUE ORO A 399 source : AC5 48) chain A residue 212 type sequence N description BINDING SITE FOR RESIDUE ORO A 399 source : AC5 49) chain A residue 215 type sequence S description BINDING SITE FOR RESIDUE ORO A 399 source : AC5 50) chain A residue 217 type sequence N description BINDING SITE FOR RESIDUE ORO A 399 source : AC5 51) chain A residue 284 type sequence N description BINDING SITE FOR RESIDUE ORO A 399 source : AC5 52) chain A residue 285 type sequence T description BINDING SITE FOR RESIDUE ORO A 399 source : AC5 53) chain A residue 144 type catalytic sequence I description 109 source MCSA : MCSA1 54) chain A residue 148 type catalytic sequence G description 109 source MCSA : MCSA1 55) chain A residue 214 type catalytic sequence S description 109 source MCSA : MCSA1 56) chain A residue 216 type catalytic sequence P description 109 source MCSA : MCSA1 57) chain A residue 217 type catalytic sequence N description 109 source MCSA : MCSA1 58) chain A residue 254 type catalytic sequence V description 109 source MCSA : MCSA1 59) chain A residue 283 type catalytic sequence T description 109 source MCSA : MCSA1 60) chain A residue 31-395 type TOPO_DOM sequence ATGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPF QDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGF GFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHG LSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAE DYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRL LTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVK ELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLS TQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLV QLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGAD HR description Mitochondrial intermembrane => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 61) chain A residue 214 type ACT_SITE sequence S description Nucleophile source Swiss-Prot : SWS_FT_FI2 62) chain A residue 114-133 type prosite sequence GFVEIGSVTPKPQEGNPRPR description DHODEHASE_1 Dihydroorotate dehydrogenase signature 1. GfveiGSVTpkpQeGNprPR source prosite : PS00911 63) chain A residue 330-350 type prosite sequence IIGVGGVSSGQDALEKIRAGA description DHODEHASE_2 Dihydroorotate dehydrogenase signature 2. IIGvGGVsSgqdAleKIrAGA source prosite : PS00912 64) chain A residue 95 type BINDING sequence A description BINDING => ECO:0000269|PubMed:10673429, ECO:0000269|PubMed:16480261 source Swiss-Prot : SWS_FT_FI3 65) chain A residue 119 type BINDING sequence G description BINDING => ECO:0000269|PubMed:10673429, ECO:0000269|PubMed:16480261 source Swiss-Prot : SWS_FT_FI3 66) chain A residue 180 type BINDING sequence V description BINDING => ECO:0000269|PubMed:10673429, ECO:0000269|PubMed:16480261 source Swiss-Prot : SWS_FT_FI3 67) chain A residue 211 type BINDING sequence V description BINDING => ECO:0000269|PubMed:10673429, ECO:0000269|PubMed:16480261 source Swiss-Prot : SWS_FT_FI3 68) chain A residue 254 type BINDING sequence V description BINDING => ECO:0000269|PubMed:10673429, ECO:0000269|PubMed:16480261 source Swiss-Prot : SWS_FT_FI3 69) chain A residue 282 type BINDING sequence V description BINDING => ECO:0000269|PubMed:10673429, ECO:0000269|PubMed:16480261 source Swiss-Prot : SWS_FT_FI3 70) chain A residue 305 type BINDING sequence S description BINDING => ECO:0000269|PubMed:10673429, ECO:0000269|PubMed:16480261 source Swiss-Prot : SWS_FT_FI3 71) chain A residue 334 type BINDING sequence G description BINDING => ECO:0000269|PubMed:10673429, ECO:0000269|PubMed:16480261 source Swiss-Prot : SWS_FT_FI3 72) chain A residue 355 type BINDING sequence L description BINDING => ECO:0000269|PubMed:10673429, ECO:0000269|PubMed:16480261 source Swiss-Prot : SWS_FT_FI3 73) chain A residue 99 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI4 74) chain A residue 144 type BINDING sequence I description source Swiss-Prot : SWS_FT_FI4 75) chain A residue 283 type BINDING sequence T description source Swiss-Prot : SWS_FT_FI4

Display surface Download Links