eF-site ID 1d1v-A PDB Code 1d1v Chain A click to enlarge Title BOVINE ENDOTHELIAL NITRIC OXIDE SYNTHASE HEME DOMAIN COMPLEXED WITH S-ETHYL-N-PHENYL-ISOTHIOUREA (H4B BOUND) Classification OXIDOREDUCTASE Compound BOVINE ENDOTHELIAL NITRIC OXIDE SYNTHASE HEME Source null (NOS3_BOVIN) Sequence A:  GPKFPRVKNWELGSITYDTLCAQSQQDGPCTPRRCLGSLV LPRKLQTRPSPGPPPAEQLLSQARDFINQYYSSIKRSGSQ AHEERLQEVEAEVASTGTYHLRESELVFGAKQAWRNAPRC VGRIQWGKLQVFDARDCSSAQEMFTYICNHIKYATNRGNL RSAITVFPQRAPGRGDFRIWNSQLVRYAGYRQQDGSVRGD PANVEITELCIQHGWTPGNGRFDVLPLLLQAPDEAPELFV LPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIG GLEFSAAPFSGWYMSTEIGTRNLCDPHRYNILEDVAVCMD LDTRTTSSLWKDKAAVEINLAVLHSFQLAKVTIVDHHAAT VSFMKHLDNEQKARGGCPADWAWIVPPISGSLTPVFHQEM VNYILSPAFRYQPDPW Description Functional site 1) chain A residue 252 type sequence R description BINDING SITE FOR RESIDUE ACT A 850 source : AC1 2) chain A residue 368 type sequence N description BINDING SITE FOR RESIDUE ACT A 850 source : AC1 3) chain A residue 374 type sequence R description BINDING SITE FOR RESIDUE ACT A 850 source : AC1 4) chain A residue 188 type sequence G description BINDING SITE FOR RESIDUE ACT A 860 source : AC2 5) chain A residue 358 type sequence W description BINDING SITE FOR RESIDUE ACT A 860 source : AC2 6) chain A residue 420 type sequence V description BINDING SITE FOR RESIDUE ACT A 860 source : AC2 7) chain A residue 428 type sequence S description BINDING SITE FOR RESIDUE ACT A 860 source : AC2 8) chain A residue 96 type sequence C description BINDING SITE FOR RESIDUE ZN A 900 source : AC5 9) chain A residue 101 type sequence C description BINDING SITE FOR RESIDUE ZN A 900 source : AC5 10) chain A residue 180 type sequence W description BINDING SITE FOR RESIDUE HEM A 500 source : AC6 11) chain A residue 185 type sequence R description BINDING SITE FOR RESIDUE HEM A 500 source : AC6 12) chain A residue 186 type sequence C description BINDING SITE FOR RESIDUE HEM A 500 source : AC6 13) chain A residue 228 type sequence S description BINDING SITE FOR RESIDUE HEM A 500 source : AC6 14) chain A residue 355 type sequence F description BINDING SITE FOR RESIDUE HEM A 500 source : AC6 15) chain A residue 356 type sequence S description BINDING SITE FOR RESIDUE HEM A 500 source : AC6 16) chain A residue 358 type sequence W description BINDING SITE FOR RESIDUE HEM A 500 source : AC6 17) chain A residue 363 type sequence E description BINDING SITE FOR RESIDUE HEM A 500 source : AC6 18) chain A residue 449 type sequence W description BINDING SITE FOR RESIDUE HEM A 500 source : AC6 19) chain A residue 477 type sequence Y description BINDING SITE FOR RESIDUE HEM A 500 source : AC6 20) chain A residue 104 type sequence S description BINDING SITE FOR RESIDUE H4B A 700 source : AC8 21) chain A residue 367 type sequence R description BINDING SITE FOR RESIDUE H4B A 700 source : AC8 22) chain A residue 448 type sequence A description BINDING SITE FOR RESIDUE H4B A 700 source : AC8 23) chain A residue 449 type sequence W description BINDING SITE FOR RESIDUE H4B A 700 source : AC8 24) chain A residue 336 type sequence P description BINDING SITE FOR RESIDUE PTU A 810 source : AC9 25) chain A residue 338 type sequence V description BINDING SITE FOR RESIDUE PTU A 810 source : AC9 26) chain A residue 355 type sequence F description BINDING SITE FOR RESIDUE PTU A 810 source : AC9 27) chain A residue 357 type sequence G description BINDING SITE FOR RESIDUE PTU A 810 source : AC9 28) chain A residue 358 type sequence W description BINDING SITE FOR RESIDUE PTU A 810 source : AC9 29) chain A residue 359 type sequence Y description BINDING SITE FOR RESIDUE PTU A 810 source : AC9 30) chain A residue 363 type sequence E description BINDING SITE FOR RESIDUE PTU A 810 source : AC9 31) chain A residue 324 type sequence W description BINDING SITE FOR RESIDUE CAD A 950 source : BC1 32) chain A residue 384 type sequence C description BINDING SITE FOR RESIDUE CAD A 950 source : BC1 33) chain A residue 438 type sequence K description BINDING SITE FOR RESIDUE CAD A 950 source : BC1 34) chain A residue 440 type sequence R description BINDING SITE FOR RESIDUE CAD A 950 source : BC1 35) chain A residue 441 type sequence G description BINDING SITE FOR RESIDUE CAD A 950 source : BC1 36) chain A residue 447 type sequence W description BINDING SITE FOR RESIDUE H4B B 701 source : BC2 37) chain A residue 462 type sequence F description BINDING SITE FOR RESIDUE H4B B 701 source : BC2 38) chain A residue 106 type sequence V description BINDING SITE FOR RESIDUE GOL A 880 source : BC5 39) chain A residue 367 type sequence R description BINDING SITE FOR RESIDUE GOL A 880 source : BC5 40) chain A residue 373 type sequence H description BINDING SITE FOR RESIDUE GOL A 880 source : BC5 41) chain A residue 449 type sequence W description BINDING SITE FOR RESIDUE GOL A 880 source : BC5 42) chain A residue 76 type sequence W description BINDING SITE FOR RESIDUE GOL B 881 source : BC6 43) chain A residue 186 type BINDING sequence C description axial binding residue => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI3 44) chain A residue 185-192 type prosite sequence RCVGRIQW description NOS Nitric oxide synthase (NOS) signature. RCVGRIqW source prosite : PS60001 45) chain A residue 116 type MOD_RES sequence S description Phosphoserine; by CDK5 => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI4 46) chain A residue 96 type BINDING sequence C description BINDING => ECO:0000250|UniProtKB:P35228 source Swiss-Prot : SWS_FT_FI1 47) chain A residue 101 type BINDING sequence C description BINDING => ECO:0000250|UniProtKB:P35228 source Swiss-Prot : SWS_FT_FI1 48) chain A residue 249 type BINDING sequence Q description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 49) chain A residue 477 type BINDING sequence Y description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 50) chain A residue 358 type BINDING sequence W description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 51) chain A residue 359 type BINDING sequence Y description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 52) chain A residue 363 type BINDING sequence E description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 53) chain A residue 368 type BINDING sequence N description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 54) chain A residue 448 type BINDING sequence A description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 55) chain A residue 449 type BINDING sequence W description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 56) chain A residue 462 type BINDING sequence F description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 57) chain A residue 104 type BINDING sequence S description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links