eF-site ID 1cy1-A PDB Code 1cy1 Chain A click to enlarge Title COMPLEX OF E.COLI DNA TOPOISOMERASE I WITH 5'PTPTPT Classification ISOMERASE Compound DNA TOPOISOMERASE I Source (TOP1_ECOLI) Sequence A:  GKALVIVESPAKAKTINKYLGSDYVVKSSVGHIRDLPRGA LVNRMGVDPWHNWEAHYEVLPGKEKVVSELKQLAEKADHI YLATDLDREGEAIAWHLREVIGGDDARYSRVVFNEITKNA IRQAFNKPGELNIDRVNAQQARRFMDRVVGYMVSPLLWKK IARGLSAGRVQSVAVRLVVEREREIKAFVPEEFWEVDAST TTPSGEALALQVTHQNDKPFRPVNKEQTQAAVSLLEKARY SVLEREDKPTTSKPGAPFITSTLQQAASTRLGFGVKKTMM MAQRLYEAGYITYMRTDSTNLSQDAVNMVRGYISDNFGKK YLPESPNQYAEAHEAIRPSDVNVMAESLKDMEADAQKLYQ LIWRQFVACQMTPAKYDSTTLTVGAGDFRLKARGRILRFD GWTKVMPALILPAVNKGDALTLVELTPAQHFTKPPARFSE ASLVKELEKRGIGRPSTYASIISTIQDRGYVRVENRRFYA EKMGEIVTDRLEENFRELMNYDFTAQMENSLDQVANHEAE WKAVLDHFFSDFTQQLDKAEKDPEEGGMRPNQMVLTS Description Functional site 1) chain A residue 202 type sequence R description BINDING SITE FOR RESIDUE PO4 A 700 source : AC1 2) chain A residue 458 type sequence A description BINDING SITE FOR RESIDUE PO4 A 700 source : AC1 3) chain A residue 535 type sequence R description BINDING SITE FOR RESIDUE PO4 A 700 source : AC1 4) chain A residue 539 type sequence N description BINDING SITE FOR RESIDUE PO4 A 700 source : AC1 5) chain A residue 113 type sequence D description BINDING SITE FOR RESIDUE TMP A 600 source : AC2 6) chain A residue 114 type sequence R description BINDING SITE FOR RESIDUE TMP A 600 source : AC2 7) chain A residue 115 type sequence E description BINDING SITE FOR RESIDUE TMP A 600 source : AC2 8) chain A residue 161 type sequence R description BINDING SITE FOR RESIDUE TMP A 600 source : AC2 9) chain A residue 165 type sequence Q description BINDING SITE FOR RESIDUE TMP A 600 source : AC2 10) chain A residue 168 type sequence R description BINDING SITE FOR RESIDUE TMP A 600 source : AC2 11) chain A residue 365 type sequence H description BINDING SITE FOR RESIDUE TMP A 600 source : AC2 12) chain A residue 493 type sequence R description BINDING SITE FOR RESIDUE TMP A 600 source : AC2 13) chain A residue 495 type sequence S description BINDING SITE FOR RESIDUE TMP A 600 source : AC2 14) chain A residue 554 type sequence A description BINDING SITE FOR RESIDUE TMP A 600 source : AC2 15) chain A residue 292 type sequence A description BINDING SITE FOR RESIDUE THP A 601 source : AC3 16) chain A residue 296 type sequence R description BINDING SITE FOR RESIDUE THP A 601 source : AC3 17) chain A residue 393 type sequence L description BINDING SITE FOR RESIDUE THP A 601 source : AC3 18) chain A residue 396 type sequence R description BINDING SITE FOR RESIDUE THP A 601 source : AC3 19) chain A residue 397 type sequence Q description BINDING SITE FOR RESIDUE THP A 601 source : AC3 20) chain A residue 434 type sequence W description BINDING SITE FOR RESIDUE THP A 601 source : AC3 21) chain A residue 438 type sequence M description BINDING SITE FOR RESIDUE THP A 601 source : AC3 22) chain A residue 291 type sequence Q description BINDING SITE FOR RESIDUE TMP A 602 source : AC4 23) chain A residue 294 type sequence S description BINDING SITE FOR RESIDUE TMP A 602 source : AC4 24) chain A residue 295 type sequence T description BINDING SITE FOR RESIDUE TMP A 602 source : AC4 25) chain A residue 478 type sequence S description BINDING SITE FOR RESIDUE TMP A 602 source : AC4 26) chain A residue 481 type sequence S description BINDING SITE FOR RESIDUE TMP A 602 source : AC4 27) chain A residue 516 type sequence R description BINDING SITE FOR RESIDUE TMP A 602 source : AC4 28) chain A residue 9 type catalytic sequence E description 366 source MCSA : MCSA1 29) chain A residue 111 type catalytic sequence D description 366 source MCSA : MCSA1 30) chain A residue 113 type catalytic sequence D description 366 source MCSA : MCSA1 31) chain A residue 115 type catalytic sequence E description 366 source MCSA : MCSA1 32) chain A residue 319 type catalytic sequence Y description 366 source MCSA : MCSA1 33) chain A residue 321 type catalytic sequence R description 366 source MCSA : MCSA1 34) chain A residue 365 type catalytic sequence H description 366 source MCSA : MCSA1 35) chain A residue 309-323 type prosite sequence QRLYEAGYITYMRTD description TOPO_IA_1 Topoisomerase (Topo) IA-type active site signature. QrLYEagy.........ITYmRTD source prosite : PS00396 36) chain A residue 319 type ACT_SITE sequence Y description O-(5'-phospho-DNA)-tyrosine intermediate => ECO:0000255|PROSITE-ProRule:PRU01383, ECO:0000269|PubMed:21482796, ECO:0000269|PubMed:8114910, ECO:0000269|PubMed:9497321 source Swiss-Prot : SWS_FT_FI1 37) chain A residue 9 type BINDING sequence E description BINDING => ECO:0000255|HAMAP-Rule:MF_00952 source Swiss-Prot : SWS_FT_FI2 38) chain A residue 111 type BINDING sequence D description BINDING => ECO:0000305 source Swiss-Prot : SWS_FT_FI3 39) chain A residue 33 type SITE sequence H description Interaction with DNA source Swiss-Prot : SWS_FT_FI4 40) chain A residue 168 type SITE sequence R description Interaction with DNA source Swiss-Prot : SWS_FT_FI4 41) chain A residue 169 type SITE sequence R description Interaction with DNA source Swiss-Prot : SWS_FT_FI4 42) chain A residue 172 type SITE sequence D description Interaction with DNA source Swiss-Prot : SWS_FT_FI4 43) chain A residue 177 type SITE sequence Y description Interaction with DNA source Swiss-Prot : SWS_FT_FI4 44) chain A residue 184 type SITE sequence W description Interaction with DNA source Swiss-Prot : SWS_FT_FI4 45) chain A residue 321 type SITE sequence R description Interaction with DNA source Swiss-Prot : SWS_FT_FI4 46) chain A residue 507 type SITE sequence R description Interaction with DNA source Swiss-Prot : SWS_FT_FI4

Display surface Download Links