eF-site ID 1cxz-AB PDB Code 1cxz Chain A, B click to enlarge Title CRYSTAL STRUCTURE OF HUMAN RHOA COMPLEXED WITH THE EFFECTOR DOMAIN OF THE PROTEIN KINASE PKN/PRK1 Classification SIGNALING PROTEIN Compound PROTEIN (HIS-TAGGED TRANSFORMING PROTEIN RHOA(0-181)) Source Homo sapiens (Human) (PKN1_HUMAN) Sequence A:  SMAAIRKKLVIVGDVACGKTCLLIVFSKDQFPEVYVPTVF ENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDV ILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKK DLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMEC SAKTKDGVREVFEMATRAALQA B:  WSLLEQLGLAGADLAAPGVQQQLELERERLRREIRKELKL KEGAENLRRATTDLGRSLGPVELLLRGSSRRLDLLHQQLQ ELHAHV Description Functional site 1) chain A residue 19 type sequence T description BINDING SITE FOR RESIDUE MG A 501 source : AC1 2) chain A residue 37 type sequence T description BINDING SITE FOR RESIDUE MG A 501 source : AC1 3) chain A residue 14 type sequence V description BINDING SITE FOR RESIDUE GSP A 500 source : AC2 4) chain A residue 15 type sequence A description BINDING SITE FOR RESIDUE GSP A 500 source : AC2 5) chain A residue 16 type sequence C description BINDING SITE FOR RESIDUE GSP A 500 source : AC2 6) chain A residue 17 type sequence G description BINDING SITE FOR RESIDUE GSP A 500 source : AC2 7) chain A residue 18 type sequence K description BINDING SITE FOR RESIDUE GSP A 500 source : AC2 8) chain A residue 19 type sequence T description BINDING SITE FOR RESIDUE GSP A 500 source : AC2 9) chain A residue 20 type sequence C description BINDING SITE FOR RESIDUE GSP A 500 source : AC2 10) chain A residue 30 type sequence F description BINDING SITE FOR RESIDUE GSP A 500 source : AC2 11) chain A residue 34 type sequence Y description BINDING SITE FOR RESIDUE GSP A 500 source : AC2 12) chain A residue 36 type sequence P description BINDING SITE FOR RESIDUE GSP A 500 source : AC2 13) chain A residue 37 type sequence T description BINDING SITE FOR RESIDUE GSP A 500 source : AC2 14) chain A residue 62 type sequence G description BINDING SITE FOR RESIDUE GSP A 500 source : AC2 15) chain A residue 118 type sequence K description BINDING SITE FOR RESIDUE GSP A 500 source : AC2 16) chain A residue 120 type sequence D description BINDING SITE FOR RESIDUE GSP A 500 source : AC2 17) chain A residue 160 type sequence S description BINDING SITE FOR RESIDUE GSP A 500 source : AC2 18) chain A residue 161 type sequence A description BINDING SITE FOR RESIDUE GSP A 500 source : AC2 19) chain A residue 162 type sequence K description BINDING SITE FOR RESIDUE GSP A 500 source : AC2 20) chain A residue 29 type BINDING sequence Q description BINDING => ECO:0000250|UniProtKB:P62820 source Swiss-Prot : SWS_FT_FI2 21) chain A residue 58 type BINDING sequence W description BINDING => ECO:0000250|UniProtKB:P62820 source Swiss-Prot : SWS_FT_FI2 22) chain A residue 159 type BINDING sequence C description BINDING => ECO:0000250|UniProtKB:P62820 source Swiss-Prot : SWS_FT_FI2 23) chain B residue 69 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI1 24) chain A residue 116 type MOD_RES sequence G description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI1 25) chain A residue 33 type MOD_RES sequence V description (Microbial infection) O-AMP-tyrosine; by Haemophilus IbpA; alternate => ECO:0000269|PubMed:19362538 source Swiss-Prot : SWS_FT_FI3 26) chain A residue 36 type MOD_RES sequence P description (Microbial infection) O-AMP-threonine; by Vibrio VopS => ECO:0000269|PubMed:19039103 source Swiss-Prot : SWS_FT_FI4 27) chain A residue 40 type MOD_RES sequence E description (Microbial infection) ADP-ribosylasparagine; by botulinum toxin => ECO:0000305|PubMed:1328215 source Swiss-Prot : SWS_FT_FI5 28) chain A residue 62 type MOD_RES sequence G description 5-glutamyl serotonin => ECO:0000250|UniProtKB:Q9QUI0 source Swiss-Prot : SWS_FT_FI6 29) chain A residue 33 type CARBOHYD sequence V description (Microbial infection) O-linked (GlcNAc) tyrosine; by Photorhabdus PAU_02230; alternate => ECO:0000269|PubMed:24141704 source Swiss-Prot : SWS_FT_FI7 30) chain A residue 36 type CARBOHYD sequence P description (Microbial infection) O-linked (Glc) threonine; by C.difficile toxins TcdA and TcdB; alternate => ECO:0000269|PubMed:24905543, ECO:0000269|PubMed:7775453, ECO:0000269|PubMed:7777059 source Swiss-Prot : SWS_FT_FI8 31) chain A residue 134 type CROSSLNK sequence M description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:23871831 source Swiss-Prot : SWS_FT_FI9

Display surface Download Links