eF-site ID 1cxc-A PDB Code 1cxc Chain A click to enlarge Title CRYSTALLIZATION AND X-RAY STRUCTURE DETERMINATION OF CYTOCHROME C2 FROM RHODOBACTER SPHAEROIDES IN THREE CRYSTAL FORMS Classification ELECTRON TRANSPORT (CYTOCHROME) Compound CYTOCHROME C2 Source ORGANISM_SCIENTIFIC: Rhodobacter sphaeroides; Sequence A:  QEGDPEAGAKAFNQCQTCHVIVDDSGTTIAGRNAKTGPNL YGVVGRTAGTQADFKGYGEGMKEAGAKGLAWDEEHFVQYV QDPTKFLKEYTGDAKAKGKMTFKLKKEADAHNIWAYLQQV AVRP Description (1)  CYTOCHROME C2, PROTOPORPHYRIN IX CONTAINING FE Functional site 1) chain A residue 15 type sequence C description BINDING SITE FOR RESIDUE HEC A 125 source : AC1 2) chain A residue 18 type sequence C description BINDING SITE FOR RESIDUE HEC A 125 source : AC1 3) chain A residue 19 type sequence H description BINDING SITE FOR RESIDUE HEC A 125 source : AC1 4) chain A residue 36 type sequence T description BINDING SITE FOR RESIDUE HEC A 125 source : AC1 5) chain A residue 38 type sequence P description BINDING SITE FOR RESIDUE HEC A 125 source : AC1 6) chain A residue 46 type sequence R description BINDING SITE FOR RESIDUE HEC A 125 source : AC1 7) chain A residue 48 type sequence A description BINDING SITE FOR RESIDUE HEC A 125 source : AC1 8) chain A residue 49 type sequence G description BINDING SITE FOR RESIDUE HEC A 125 source : AC1 9) chain A residue 57 type sequence Y description BINDING SITE FOR RESIDUE HEC A 125 source : AC1 10) chain A residue 58 type sequence G description BINDING SITE FOR RESIDUE HEC A 125 source : AC1 11) chain A residue 61 type sequence M description BINDING SITE FOR RESIDUE HEC A 125 source : AC1 12) chain A residue 71 type sequence W description BINDING SITE FOR RESIDUE HEC A 125 source : AC1 13) chain A residue 76 type sequence F description BINDING SITE FOR RESIDUE HEC A 125 source : AC1 14) chain A residue 79 type sequence Y description BINDING SITE FOR RESIDUE HEC A 125 source : AC1 15) chain A residue 98 type sequence G description BINDING SITE FOR RESIDUE HEC A 125 source : AC1 16) chain A residue 99 type sequence K description BINDING SITE FOR RESIDUE HEC A 125 source : AC1 17) chain A residue 100 type sequence M description BINDING SITE FOR RESIDUE HEC A 125 source : AC1 18) chain A residue 102 type sequence F description BINDING SITE FOR RESIDUE HEC A 125 source : AC1 19) chain A residue 15 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 20) chain A residue 18 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 21) chain A residue 19 type BINDING sequence H description axial binding residue source Swiss-Prot : SWS_FT_FI2 22) chain A residue 79 type BINDING sequence Y description axial binding residue source Swiss-Prot : SWS_FT_FI2 23) chain A residue 1 type MOD_RES sequence Q description Pyrrolidone carboxylic acid => ECO:0000269|PubMed:8827449 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links