eF-site ID 1cw0-A PDB Code 1cw0 Chain A click to enlarge Title CRYSTAL STRUCTURE ANALYSIS OF VERY SHORT PATCH REPAIR (VSR) ENDONUCLEASE IN COMPLEX WITH A DUPLEX DNA Classification HYDROLASE/DNA Compound DNA (5'-D(*AP*CP*GP*TP*AP*CP*CP*TP*GP*GP*CP*T)-3') Source Escherichia coli (strain K12) (1CW0) Sequence A:  ADVHDKATRSKNMRAIATRDTAIEKRLASLLTGQGLAFRV QDASLPGRPDFVVDEYRCVIFTHGCFWHHHHCYLFKVPAT RTEFWLEKIGKNVERDRRDISRLQELGWRVLIVWECALRG REKLTDEALTERLEEWICGEGASAQIDTQGIHLLA Description Functional site 1) chain A residue 66 type sequence C description BINDING SITE FOR RESIDUE ZN A 201 source : AC1 2) chain A residue 71 type sequence H description BINDING SITE FOR RESIDUE ZN A 201 source : AC1 3) chain A residue 73 type sequence C description BINDING SITE FOR RESIDUE ZN A 201 source : AC1 4) chain A residue 117 type sequence C description BINDING SITE FOR RESIDUE ZN A 201 source : AC1 5) chain A residue 49 type sequence R description BINDING SITE FOR RESIDUE MG N 202 source : AC2 6) chain A residue 51 type sequence D description BINDING SITE FOR RESIDUE MG N 202 source : AC2 7) chain A residue 51 type sequence D description BINDING SITE FOR RESIDUE MG A 203 source : AC3 8) chain A residue 63 type sequence T description BINDING SITE FOR RESIDUE MG A 203 source : AC3 9) chain A residue 52 type BINDING sequence F description source Swiss-Prot : SWS_FT_FI1 10) chain A residue 64 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 11) chain A residue 52 type catalytic sequence F description 839 source MCSA : MCSA1 12) chain A residue 64 type catalytic sequence H description 839 source MCSA : MCSA1 13) chain A residue 70 type catalytic sequence H description 839 source MCSA : MCSA1 14) chain A residue 98 type catalytic sequence R description 839 source MCSA : MCSA1

Display surface Download Links