eF-site ID 1cqi-E
PDB Code 1cqi
Chain E

click to enlarge
Title Crystal Structure of the Complex of ADP and MG2+ with Dephosphorylated E. Coli Succinyl-CoA Synthetase
Classification LIGASE
Compound PROTEIN (SUCCINYL-COA SYNTHETASE ALPHA CHAIN)
Source (SUCC_ECOLI)
Sequence E:  MNLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIGA
GPWVVKCQVHAGGRGKAGGVKVVNSKEDIRAFAENWLGKR
LVTYQTDANGQPVNQILVEAATDIAKELYLGAVVDRSSRR
VVFMASTEGGVEIEKVAEETPHLIHKVALDPLTGPMPYQG
RELAFKLGLEGKLVQQFTKIFMGLATIFLERDLALIEINP
LVITKQGDLICLDGKLGADGNALFRQPDLREMRDQSQEDP
REAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHG
GEPANFLDVGGGATKERVTEAFKIILSDDKVKAVLVNIFG
GIVRCDLIADGIIGAVAEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAAKGLTDAAQQVVAAV
Description (1)  SUCCINYL-COA SYNTHETASE ALPHA AND BETA SUBUNITS (E.C.6.2.1.5)


Functional site

1) chain E
residue 199
type
ligand
sequence N
description BINDING SITE FOR RESIDUE MG E 502
source : AC2

2) chain E
residue 213
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MG E 502
source : AC2

3) chain E
residue 265
type
ligand
sequence G
description BINDING SITE FOR RESIDUE PO4 D 602
source : AC4

4) chain E
residue 266
type
ligand
sequence A
description BINDING SITE FOR RESIDUE PO4 D 602
source : AC4

5) chain E
residue 267
type
ligand
sequence G
description BINDING SITE FOR RESIDUE PO4 D 602
source : AC4

6) chain E
residue 29
type
ligand
sequence R
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

7) chain E
residue 33
type
ligand
sequence E
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

8) chain E
residue 36
type
ligand
sequence S
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

9) chain E
residue 66
type
ligand
sequence K
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

10) chain E
residue 44
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ADP E 802
source : AC8

11) chain E
residue 46
type
ligand
sequence K
description BINDING SITE FOR RESIDUE ADP E 802
source : AC8

12) chain E
residue 53
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP E 802
source : AC8

13) chain E
residue 54
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP E 802
source : AC8

14) chain E
residue 55
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP E 802
source : AC8

15) chain E
residue 99
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP E 802
source : AC8

16) chain E
residue 100
type
ligand
sequence A
description BINDING SITE FOR RESIDUE ADP E 802
source : AC8

17) chain E
residue 101
type
ligand
sequence A
description BINDING SITE FOR RESIDUE ADP E 802
source : AC8

18) chain E
residue 102
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ADP E 802
source : AC8

19) chain E
residue 107
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP E 802
source : AC8

20) chain E
residue 199
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ADP E 802
source : AC8

21) chain E
residue 200
type
ligand
sequence P
description BINDING SITE FOR RESIDUE ADP E 802
source : AC8

22) chain E
residue 212
type
ligand
sequence L
description BINDING SITE FOR RESIDUE ADP E 802
source : AC8

23) chain E
residue 213
type
ligand
sequence D
description BINDING SITE FOR RESIDUE ADP E 802
source : AC8

24) chain E
residue 257-282
type prosite
ligand
sequence GNIGCMVNGAGLAMGTMDIVKLHGGE
description ATP-citrate lyase / succinyl-CoA ligases family signature 3. G-x-[IVT]-x(2)-[LIVMF]-x-[NAK]-[GS]-[GA]-G-[LMAI]-[STAV]-x(4)-[DN]-x
source prosite : PS01217

25) chain E
residue 29
type binding
ligand COA: COENZYME A
sequence R
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_A_701

26) chain E
residue 32-33
type binding
ligand COA: COENZYME A
sequence EE
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_A_701

27) chain E
residue 36
type binding
ligand COA: COENZYME A
sequence S
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_A_701

28) chain E
residue 66
type binding
ligand COA: COENZYME A
sequence K
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_A_701

29) chain E
residue 5
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence E
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_1cqi_E_802

30) chain E
residue 20
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence P
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_1cqi_E_802

31) chain E
residue 44
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence V
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_1cqi_E_802

32) chain E
residue 46
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence K
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_1cqi_E_802

33) chain E
residue 51-56
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence AGGRGK
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_1cqi_E_802

34) chain E
residue 60
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence V
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_1cqi_E_802

35) chain E
residue 99-102
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence EAAT
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_1cqi_E_802

36) chain E
residue 104
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence I
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_1cqi_E_802

37) chain E
residue 107
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence E
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_1cqi_E_802

38) chain E
residue 130
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence G
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_1cqi_E_802

39) chain E
residue 199-200
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence NP
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_1cqi_E_802

40) chain E
residue 212-213
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence LD
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_1cqi_E_802

41) chain E
residue 109
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1cqj
source CSA : CSA4

42) chain E
residue 197
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1cqj
source CSA : CSA4


Display surface

Download
Links