eF-site ID 1cqi-D
PDB Code 1cqi
Chain D

click to enlarge
Title Crystal Structure of the Complex of ADP and MG2+ with Dephosphorylated E. Coli Succinyl-CoA Synthetase
Classification LIGASE
Compound PROTEIN (SUCCINYL-COA SYNTHETASE ALPHA CHAIN)
Source (SUCC_ECOLI)
Sequence D:  SILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTP
GKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDS
ILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIG
PNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEA
VKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQT
EAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAPK
GKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIG
EALKTV
Description (1)  SUCCINYL-COA SYNTHETASE ALPHA AND BETA SUBUNITS (E.C.6.2.1.5)


Functional site

1) chain D
residue 153
type
ligand
sequence S
description BINDING SITE FOR RESIDUE PO4 D 602
source : AC4

2) chain D
residue 154
type
ligand
sequence G
description BINDING SITE FOR RESIDUE PO4 D 602
source : AC4

3) chain D
residue 155
type
ligand
sequence T
description BINDING SITE FOR RESIDUE PO4 D 602
source : AC4

4) chain D
residue 246
type
ligand
sequence H
description BINDING SITE FOR RESIDUE PO4 D 602
source : AC4

5) chain D
residue 14
type
ligand
sequence G
description BINDING SITE FOR RESIDUE COA D 702
source : AC6

6) chain D
residue 16
type
ligand
sequence T
description BINDING SITE FOR RESIDUE COA D 702
source : AC6

7) chain D
residue 17
type
ligand
sequence G
description BINDING SITE FOR RESIDUE COA D 702
source : AC6

8) chain D
residue 18
type
ligand
sequence S
description BINDING SITE FOR RESIDUE COA D 702
source : AC6

9) chain D
residue 19
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE COA D 702
source : AC6

10) chain D
residue 40
type
ligand
sequence P
description BINDING SITE FOR RESIDUE COA D 702
source : AC6

11) chain D
residue 42
type
ligand
sequence K
description BINDING SITE FOR RESIDUE COA D 702
source : AC6

12) chain D
residue 71
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE COA D 702
source : AC6

13) chain D
residue 72
type
ligand
sequence V
description BINDING SITE FOR RESIDUE COA D 702
source : AC6

14) chain D
residue 73
type
ligand
sequence P
description BINDING SITE FOR RESIDUE COA D 702
source : AC6

15) chain D
residue 95
type
ligand
sequence I
description BINDING SITE FOR RESIDUE COA D 702
source : AC6

16) chain D
residue 96
type
ligand
sequence T
description BINDING SITE FOR RESIDUE COA D 702
source : AC6

17) chain D
residue 97
type
ligand
sequence E
description BINDING SITE FOR RESIDUE COA D 702
source : AC6

18) chain D
residue 123
type
ligand
sequence C
description BINDING SITE FOR RESIDUE COA D 702
source : AC6

19) chain D
residue 136
type
ligand
sequence I
description BINDING SITE FOR RESIDUE COA D 702
source : AC6

20) chain D
residue 13-14
type binding
ligand COA: COENZYME A
sequence QG
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_D_702

21) chain D
residue 16-20
type binding
ligand COA: COENZYME A
sequence TGSQG
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_D_702

22) chain D
residue 38-40
type binding
ligand COA: COENZYME A
sequence VTP
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_D_702

23) chain D
residue 42
type binding
ligand COA: COENZYME A
sequence K
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_D_702

24) chain D
residue 71-74
type binding
ligand COA: COENZYME A
sequence YVPA
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_D_702

25) chain D
residue 76
type binding
ligand COA: COENZYME A
sequence F
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_D_702

26) chain D
residue 79-80
type binding
ligand COA: COENZYME A
sequence DS
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_D_702

27) chain D
residue 83
type binding
ligand COA: COENZYME A
sequence E
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_D_702

28) chain D
residue 95-97
type binding
ligand COA: COENZYME A
sequence ITE
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_D_702

29) chain D
residue 123
type binding
ligand COA: COENZYME A
sequence C
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_D_702

30) chain D
residue 136
type binding
ligand COA: COENZYME A
sequence I
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_D_702

31) chain D
residue 208
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1cqj
source CSA : CSA2

32) chain D
residue 246
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 1cqj
source CSA : CSA2


Display surface

Download
Links