eF-site ID 1cqi-ABDE
PDB Code 1cqi
Chain A, B, D, E

click to enlarge
Title Crystal Structure of the Complex of ADP and MG2+ with Dephosphorylated E. Coli Succinyl-CoA Synthetase
Classification LIGASE
Compound PROTEIN (SUCCINYL-COA SYNTHETASE ALPHA CHAIN)
Source (SUCC_ECOLI)
Sequence A:  SILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTP
GKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDS
ILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIG
PNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEA
VKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQT
EAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAPK
GKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIG
EALKTV
B:  MNLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIGA
GPWVVKCQVHAGGRGKAGGVKVVNSKEDIRAFAENWLGKR
LVTYQTDANGQPVNQILVEAATDIAKELYLGAVVDRSSRR
VVFMASTEGGVEIEKVAEETPHLIHKVALDPLTGPMPYQG
RELAFKLGLEGKLVQQFTKIFMGLATIFLERDLALIEINP
LVITKQGDLICLDGKLGADGNALFRQPDLREMRDQSQEDP
REAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHG
GEPANFLDVGGGATKERVTEAFKIILSDDKVKAVLVNIFG
GIVRCDLIADGIIGAVAEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAAKGLTDAAQQVVAAV
D:  SILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTP
GKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDS
ILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIG
PNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEA
VKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQT
EAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAPK
GKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIG
EALKTV
E:  MNLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIGA
GPWVVKCQVHAGGRGKAGGVKVVNSKEDIRAFAENWLGKR
LVTYQTDANGQPVNQILVEAATDIAKELYLGAVVDRSSRR
VVFMASTEGGVEIEKVAEETPHLIHKVALDPLTGPMPYQG
RELAFKLGLEGKLVQQFTKIFMGLATIFLERDLALIEINP
LVITKQGDLICLDGKLGADGNALFRQPDLREMRDQSQEDP
REAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHG
GEPANFLDVGGGATKERVTEAFKIILSDDKVKAVLVNIFG
GIVRCDLIADGIIGAVAEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAAKGLTDAAQQVVAAV
Description (1)  SUCCINYL-COA SYNTHETASE ALPHA AND BETA SUBUNITS (E.C.6.2.1.5)


Functional site

1) chain B
residue 199
type
ligand
sequence N
description BINDING SITE FOR RESIDUE MG B 501
source : AC1

2) chain B
residue 213
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MG B 501
source : AC1

3) chain E
residue 199
type
ligand
sequence N
description BINDING SITE FOR RESIDUE MG E 502
source : AC2

4) chain E
residue 213
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MG E 502
source : AC2

5) chain A
residue 153
type
ligand
sequence S
description BINDING SITE FOR RESIDUE PO4 A 601
source : AC3

6) chain A
residue 154
type
ligand
sequence G
description BINDING SITE FOR RESIDUE PO4 A 601
source : AC3

7) chain A
residue 155
type
ligand
sequence T
description BINDING SITE FOR RESIDUE PO4 A 601
source : AC3

8) chain A
residue 246
type
ligand
sequence H
description BINDING SITE FOR RESIDUE PO4 A 601
source : AC3

9) chain B
residue 265
type
ligand
sequence G
description BINDING SITE FOR RESIDUE PO4 A 601
source : AC3

10) chain B
residue 266
type
ligand
sequence A
description BINDING SITE FOR RESIDUE PO4 A 601
source : AC3

11) chain B
residue 267
type
ligand
sequence G
description BINDING SITE FOR RESIDUE PO4 A 601
source : AC3

12) chain D
residue 153
type
ligand
sequence S
description BINDING SITE FOR RESIDUE PO4 D 602
source : AC4

13) chain D
residue 154
type
ligand
sequence G
description BINDING SITE FOR RESIDUE PO4 D 602
source : AC4

14) chain D
residue 155
type
ligand
sequence T
description BINDING SITE FOR RESIDUE PO4 D 602
source : AC4

15) chain D
residue 246
type
ligand
sequence H
description BINDING SITE FOR RESIDUE PO4 D 602
source : AC4

16) chain E
residue 265
type
ligand
sequence G
description BINDING SITE FOR RESIDUE PO4 D 602
source : AC4

17) chain E
residue 266
type
ligand
sequence A
description BINDING SITE FOR RESIDUE PO4 D 602
source : AC4

18) chain E
residue 267
type
ligand
sequence G
description BINDING SITE FOR RESIDUE PO4 D 602
source : AC4

19) chain A
residue 14
type
ligand
sequence G
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

20) chain A
residue 16
type
ligand
sequence T
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

21) chain A
residue 17
type
ligand
sequence G
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

22) chain A
residue 18
type
ligand
sequence S
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

23) chain A
residue 19
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

24) chain A
residue 40
type
ligand
sequence P
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

25) chain A
residue 42
type
ligand
sequence K
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

26) chain A
residue 71
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

27) chain A
residue 72
type
ligand
sequence V
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

28) chain A
residue 73
type
ligand
sequence P
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

29) chain A
residue 95
type
ligand
sequence I
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

30) chain A
residue 96
type
ligand
sequence T
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

31) chain A
residue 97
type
ligand
sequence E
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

32) chain A
residue 123
type
ligand
sequence C
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

33) chain A
residue 136
type
ligand
sequence I
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

34) chain B
residue 161
type
ligand
sequence R
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

35) chain E
residue 29
type
ligand
sequence R
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

36) chain E
residue 33
type
ligand
sequence E
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

37) chain E
residue 36
type
ligand
sequence S
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

38) chain E
residue 66
type
ligand
sequence K
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

39) chain B
residue 29
type
ligand
sequence R
description BINDING SITE FOR RESIDUE COA D 702
source : AC6

40) chain B
residue 33
type
ligand
sequence E
description BINDING SITE FOR RESIDUE COA D 702
source : AC6

41) chain B
residue 36
type
ligand
sequence S
description BINDING SITE FOR RESIDUE COA D 702
source : AC6

42) chain B
residue 66
type
ligand
sequence K
description BINDING SITE FOR RESIDUE COA D 702
source : AC6

43) chain D
residue 14
type
ligand
sequence G
description BINDING SITE FOR RESIDUE COA D 702
source : AC6

44) chain D
residue 16
type
ligand
sequence T
description BINDING SITE FOR RESIDUE COA D 702
source : AC6

45) chain D
residue 17
type
ligand
sequence G
description BINDING SITE FOR RESIDUE COA D 702
source : AC6

46) chain D
residue 18
type
ligand
sequence S
description BINDING SITE FOR RESIDUE COA D 702
source : AC6

47) chain D
residue 19
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE COA D 702
source : AC6

48) chain D
residue 40
type
ligand
sequence P
description BINDING SITE FOR RESIDUE COA D 702
source : AC6

49) chain D
residue 42
type
ligand
sequence K
description BINDING SITE FOR RESIDUE COA D 702
source : AC6

50) chain D
residue 71
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE COA D 702
source : AC6

51) chain D
residue 72
type
ligand
sequence V
description BINDING SITE FOR RESIDUE COA D 702
source : AC6

52) chain D
residue 73
type
ligand
sequence P
description BINDING SITE FOR RESIDUE COA D 702
source : AC6

53) chain D
residue 95
type
ligand
sequence I
description BINDING SITE FOR RESIDUE COA D 702
source : AC6

54) chain D
residue 96
type
ligand
sequence T
description BINDING SITE FOR RESIDUE COA D 702
source : AC6

55) chain D
residue 97
type
ligand
sequence E
description BINDING SITE FOR RESIDUE COA D 702
source : AC6

56) chain D
residue 123
type
ligand
sequence C
description BINDING SITE FOR RESIDUE COA D 702
source : AC6

57) chain D
residue 136
type
ligand
sequence I
description BINDING SITE FOR RESIDUE COA D 702
source : AC6

58) chain B
residue 44
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ADP B 801
source : AC7

59) chain B
residue 46
type
ligand
sequence K
description BINDING SITE FOR RESIDUE ADP B 801
source : AC7

60) chain B
residue 53
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP B 801
source : AC7

61) chain B
residue 54
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP B 801
source : AC7

62) chain B
residue 55
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP B 801
source : AC7

63) chain B
residue 99
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP B 801
source : AC7

64) chain B
residue 100
type
ligand
sequence A
description BINDING SITE FOR RESIDUE ADP B 801
source : AC7

65) chain B
residue 101
type
ligand
sequence A
description BINDING SITE FOR RESIDUE ADP B 801
source : AC7

66) chain B
residue 102
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ADP B 801
source : AC7

67) chain B
residue 107
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP B 801
source : AC7

68) chain B
residue 199
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ADP B 801
source : AC7

69) chain B
residue 200
type
ligand
sequence P
description BINDING SITE FOR RESIDUE ADP B 801
source : AC7

70) chain B
residue 212
type
ligand
sequence L
description BINDING SITE FOR RESIDUE ADP B 801
source : AC7

71) chain B
residue 213
type
ligand
sequence D
description BINDING SITE FOR RESIDUE ADP B 801
source : AC7

72) chain E
residue 44
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ADP E 802
source : AC8

73) chain E
residue 46
type
ligand
sequence K
description BINDING SITE FOR RESIDUE ADP E 802
source : AC8

74) chain E
residue 53
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP E 802
source : AC8

75) chain E
residue 54
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP E 802
source : AC8

76) chain E
residue 55
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP E 802
source : AC8

77) chain E
residue 99
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP E 802
source : AC8

78) chain E
residue 100
type
ligand
sequence A
description BINDING SITE FOR RESIDUE ADP E 802
source : AC8

79) chain E
residue 101
type
ligand
sequence A
description BINDING SITE FOR RESIDUE ADP E 802
source : AC8

80) chain E
residue 102
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ADP E 802
source : AC8

81) chain E
residue 107
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP E 802
source : AC8

82) chain E
residue 199
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ADP E 802
source : AC8

83) chain E
residue 200
type
ligand
sequence P
description BINDING SITE FOR RESIDUE ADP E 802
source : AC8

84) chain E
residue 212
type
ligand
sequence L
description BINDING SITE FOR RESIDUE ADP E 802
source : AC8

85) chain E
residue 213
type
ligand
sequence D
description BINDING SITE FOR RESIDUE ADP E 802
source : AC8

86) chain B
residue 257-282
type prosite
ligand
sequence GNIGCMVNGAGLAMGTMDIVKLHGGE
description ATP-citrate lyase / succinyl-CoA ligases family signature 3. G-x-[IVT]-x(2)-[LIVMF]-x-[NAK]-[GS]-[GA]-G-[LMAI]-[STAV]-x(4)-[DN]-x
source prosite : PS01217

87) chain E
residue 257-282
type prosite
ligand
sequence GNIGCMVNGAGLAMGTMDIVKLHGGE
description ATP-citrate lyase / succinyl-CoA ligases family signature 3. G-x-[IVT]-x(2)-[LIVMF]-x-[NAK]-[GS]-[GA]-G-[LMAI]-[STAV]-x(4)-[DN]-x
source prosite : PS01217

88) chain A
residue 13-14
type binding
ligand COA: COENZYME A
sequence QG
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_A_701

89) chain A
residue 16-20
type binding
ligand COA: COENZYME A
sequence TGSQG
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_A_701

90) chain A
residue 38-40
type binding
ligand COA: COENZYME A
sequence VTP
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_A_701

91) chain A
residue 42
type binding
ligand COA: COENZYME A
sequence K
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_A_701

92) chain A
residue 71-74
type binding
ligand COA: COENZYME A
sequence YVPA
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_A_701

93) chain A
residue 76
type binding
ligand COA: COENZYME A
sequence F
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_A_701

94) chain A
residue 79-80
type binding
ligand COA: COENZYME A
sequence DS
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_A_701

95) chain A
residue 83
type binding
ligand COA: COENZYME A
sequence E
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_A_701

96) chain A
residue 95-97
type binding
ligand COA: COENZYME A
sequence ITE
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_A_701

97) chain A
residue 122-123
type binding
ligand COA: COENZYME A
sequence NC
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_A_701

98) chain A
residue 136
type binding
ligand COA: COENZYME A
sequence I
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_A_701

99) chain E
residue 29
type binding
ligand COA: COENZYME A
sequence R
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_A_701

100) chain E
residue 32-33
type binding
ligand COA: COENZYME A
sequence EE
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_A_701

101) chain E
residue 36
type binding
ligand COA: COENZYME A
sequence S
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_A_701

102) chain E
residue 66
type binding
ligand COA: COENZYME A
sequence K
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_A_701

103) chain B
residue 5
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence E
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_1cqi_B_801

104) chain B
residue 20
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence P
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_1cqi_B_801

105) chain B
residue 44
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence V
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_1cqi_B_801

106) chain B
residue 46
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence K
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_1cqi_B_801

107) chain B
residue 51-56
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence AGGRGK
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_1cqi_B_801

108) chain B
residue 60
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence V
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_1cqi_B_801

109) chain B
residue 99-102
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence EAAT
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_1cqi_B_801

110) chain B
residue 104
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence I
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_1cqi_B_801

111) chain B
residue 107
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence E
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_1cqi_B_801

112) chain B
residue 130
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence G
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_1cqi_B_801

113) chain B
residue 199-200
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence NP
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_1cqi_B_801

114) chain B
residue 212-213
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence LD
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_1cqi_B_801

115) chain B
residue 29
type binding
ligand COA: COENZYME A
sequence R
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_D_702

116) chain B
residue 32-33
type binding
ligand COA: COENZYME A
sequence EE
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_D_702

117) chain B
residue 36
type binding
ligand COA: COENZYME A
sequence S
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_D_702

118) chain B
residue 66
type binding
ligand COA: COENZYME A
sequence K
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_D_702

119) chain D
residue 13-14
type binding
ligand COA: COENZYME A
sequence QG
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_D_702

120) chain D
residue 16-20
type binding
ligand COA: COENZYME A
sequence TGSQG
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_D_702

121) chain D
residue 38-40
type binding
ligand COA: COENZYME A
sequence VTP
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_D_702

122) chain D
residue 42
type binding
ligand COA: COENZYME A
sequence K
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_D_702

123) chain D
residue 71-74
type binding
ligand COA: COENZYME A
sequence YVPA
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_D_702

124) chain D
residue 76
type binding
ligand COA: COENZYME A
sequence F
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_D_702

125) chain D
residue 79-80
type binding
ligand COA: COENZYME A
sequence DS
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_D_702

126) chain D
residue 83
type binding
ligand COA: COENZYME A
sequence E
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_D_702

127) chain D
residue 95-97
type binding
ligand COA: COENZYME A
sequence ITE
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_D_702

128) chain D
residue 123
type binding
ligand COA: COENZYME A
sequence C
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_D_702

129) chain D
residue 136
type binding
ligand COA: COENZYME A
sequence I
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_D_702

130) chain E
residue 5
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence E
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_1cqi_E_802

131) chain E
residue 20
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence P
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_1cqi_E_802

132) chain E
residue 44
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence V
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_1cqi_E_802

133) chain E
residue 46
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence K
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_1cqi_E_802

134) chain E
residue 51-56
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence AGGRGK
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_1cqi_E_802

135) chain E
residue 60
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence V
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_1cqi_E_802

136) chain E
residue 99-102
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence EAAT
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_1cqi_E_802

137) chain E
residue 104
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence I
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_1cqi_E_802

138) chain E
residue 107
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence E
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_1cqi_E_802

139) chain E
residue 130
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence G
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_1cqi_E_802

140) chain E
residue 199-200
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence NP
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_1cqi_E_802

141) chain E
residue 212-213
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence LD
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_1cqi_E_802

142) chain A
residue 208
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1cqj
source CSA : CSA1

143) chain A
residue 246
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 1cqj
source CSA : CSA1

144) chain D
residue 208
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1cqj
source CSA : CSA2

145) chain D
residue 246
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 1cqj
source CSA : CSA2

146) chain B
residue 109
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1cqj
source CSA : CSA3

147) chain B
residue 197
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1cqj
source CSA : CSA3

148) chain E
residue 109
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1cqj
source CSA : CSA4

149) chain E
residue 197
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1cqj
source CSA : CSA4


Display surface

Download
Links