eF-site ID 1cqi-A
PDB Code 1cqi
Chain A

click to enlarge
Title Crystal Structure of the Complex of ADP and MG2+ with Dephosphorylated E. Coli Succinyl-CoA Synthetase
Classification LIGASE
Compound PROTEIN (SUCCINYL-COA SYNTHETASE ALPHA CHAIN)
Source (SUCC_ECOLI)
Sequence A:  SILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTP
GKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDS
ILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIG
PNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEA
VKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQT
EAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAPK
GKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIG
EALKTV
Description (1)  SUCCINYL-COA SYNTHETASE ALPHA AND BETA SUBUNITS (E.C.6.2.1.5)


Functional site

1) chain A
residue 153
type
ligand
sequence S
description BINDING SITE FOR RESIDUE PO4 A 601
source : AC3

2) chain A
residue 154
type
ligand
sequence G
description BINDING SITE FOR RESIDUE PO4 A 601
source : AC3

3) chain A
residue 155
type
ligand
sequence T
description BINDING SITE FOR RESIDUE PO4 A 601
source : AC3

4) chain A
residue 246
type
ligand
sequence H
description BINDING SITE FOR RESIDUE PO4 A 601
source : AC3

5) chain A
residue 14
type
ligand
sequence G
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

6) chain A
residue 16
type
ligand
sequence T
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

7) chain A
residue 17
type
ligand
sequence G
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

8) chain A
residue 18
type
ligand
sequence S
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

9) chain A
residue 19
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

10) chain A
residue 40
type
ligand
sequence P
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

11) chain A
residue 42
type
ligand
sequence K
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

12) chain A
residue 71
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

13) chain A
residue 72
type
ligand
sequence V
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

14) chain A
residue 73
type
ligand
sequence P
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

15) chain A
residue 95
type
ligand
sequence I
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

16) chain A
residue 96
type
ligand
sequence T
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

17) chain A
residue 97
type
ligand
sequence E
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

18) chain A
residue 123
type
ligand
sequence C
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

19) chain A
residue 136
type
ligand
sequence I
description BINDING SITE FOR RESIDUE COA A 701
source : AC5

20) chain A
residue 13-14
type binding
ligand COA: COENZYME A
sequence QG
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_A_701

21) chain A
residue 16-20
type binding
ligand COA: COENZYME A
sequence TGSQG
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_A_701

22) chain A
residue 38-40
type binding
ligand COA: COENZYME A
sequence VTP
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_A_701

23) chain A
residue 42
type binding
ligand COA: COENZYME A
sequence K
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_A_701

24) chain A
residue 71-74
type binding
ligand COA: COENZYME A
sequence YVPA
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_A_701

25) chain A
residue 76
type binding
ligand COA: COENZYME A
sequence F
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_A_701

26) chain A
residue 79-80
type binding
ligand COA: COENZYME A
sequence DS
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_A_701

27) chain A
residue 83
type binding
ligand COA: COENZYME A
sequence E
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_A_701

28) chain A
residue 95-97
type binding
ligand COA: COENZYME A
sequence ITE
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_A_701

29) chain A
residue 122-123
type binding
ligand COA: COENZYME A
sequence NC
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_A_701

30) chain A
residue 136
type binding
ligand COA: COENZYME A
sequence I
description COENZYME A binding site
source pdb_hetatom : COA_1cqi_A_701

31) chain A
residue 208
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1cqj
source CSA : CSA1

32) chain A
residue 246
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 1cqj
source CSA : CSA1


Display surface

Download
Links