eF-site ID 1co7-E PDB Code 1co7 Chain E click to enlarge Title R117H mutant rat anionic trypsin complexed with bovine pancreatic trypsin inhibitor (BPTI) Classification HYDROLASE/HYDROLASE INHIBITOR Compound TRYPSIN II Source ORGANISM_COMMON: Norway rat; ORGANISM_SCIENTIFIC: Rattus norvegicus; Sequence E:  IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAH CYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKT LNNDIMLIKLSSPVKLNAHVATVALPSSCAPAGTQCLISG WGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNM VCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALP DNPGVYTKVCNYVDWIQDTIAAN Description Functional site 1) chain E residue 57 type sequence H description THE CATALYTIC TRIAD source : CAT 2) chain E residue 102 type sequence D description THE CATALYTIC TRIAD source : CAT 3) chain E residue 195 type sequence S description THE CATALYTIC TRIAD source : CAT 4) chain E residue 70 type sequence E description BINDING SITE FOR RESIDUE CA E 800 source : AC1 5) chain E residue 72 type sequence N description BINDING SITE FOR RESIDUE CA E 800 source : AC1 6) chain E residue 75 type sequence V description BINDING SITE FOR RESIDUE CA E 800 source : AC1 7) chain E residue 77 type sequence E description BINDING SITE FOR RESIDUE CA E 800 source : AC1 8) chain E residue 80 type sequence E description BINDING SITE FOR RESIDUE CA E 800 source : AC1 9) chain E residue 70 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI2 10) chain E residue 72 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2 11) chain E residue 75 type BINDING sequence V description source Swiss-Prot : SWS_FT_FI2 12) chain E residue 80 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI2 13) chain E residue 189 type SITE sequence D description Required for specificity => ECO:0000250 source Swiss-Prot : SWS_FT_FI3 14) chain E residue 102 type SITE sequence D description Reactive bond for trypsin source Swiss-Prot : SWS_FT_FI1 15) chain E residue 195 type SITE sequence S description Reactive bond for trypsin source Swiss-Prot : SWS_FT_FI1 16) chain E residue 53-58 type prosite sequence VSAAHC description TRYPSIN_HIS Serine proteases, trypsin family, histidine active site. VSAAHC source prosite : PS00134 17) chain E residue 189-200 type prosite sequence DSCQGDSGGPVV description TRYPSIN_SER Serine proteases, trypsin family, serine active site. DScqGDSGGPVV source prosite : PS00135

Display surface Download Links