eF-site ID 1clm-A PDB Code 1clm Chain A click to enlarge Title STRUCTURE OF PARAMECIUM TETRAURELIA CALMODULIN AT 1.8 ANGSTROMS RESOLUTION Classification CALCIUM-BINDING PROTEIN Compound CALMODULIN Source Paramecium tetraurelia (CALM_PARTE) Sequence A:  LTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNP TEAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQDSEE ELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDDEVDE MIREADIDGDGHINYEEFVRMMVS Description Functional site 1) chain A residue 20 type sequence D description BINDING SITE FOR RESIDUE CA A 149 source : AC1 2) chain A residue 22 type sequence D description BINDING SITE FOR RESIDUE CA A 149 source : AC1 3) chain A residue 24 type sequence D description BINDING SITE FOR RESIDUE CA A 149 source : AC1 4) chain A residue 26 type sequence T description BINDING SITE FOR RESIDUE CA A 149 source : AC1 5) chain A residue 31 type sequence E description BINDING SITE FOR RESIDUE CA A 149 source : AC1 6) chain A residue 56 type sequence D description BINDING SITE FOR RESIDUE CA A 150 source : AC2 7) chain A residue 58 type sequence D description BINDING SITE FOR RESIDUE CA A 150 source : AC2 8) chain A residue 60 type sequence N description BINDING SITE FOR RESIDUE CA A 150 source : AC2 9) chain A residue 62 type sequence T description BINDING SITE FOR RESIDUE CA A 150 source : AC2 10) chain A residue 67 type sequence E description BINDING SITE FOR RESIDUE CA A 150 source : AC2 11) chain A residue 93 type sequence D description BINDING SITE FOR RESIDUE CA A 151 source : AC3 12) chain A residue 95 type sequence D description BINDING SITE FOR RESIDUE CA A 151 source : AC3 13) chain A residue 97 type sequence N description BINDING SITE FOR RESIDUE CA A 151 source : AC3 14) chain A residue 99 type sequence L description BINDING SITE FOR RESIDUE CA A 151 source : AC3 15) chain A residue 104 type sequence E description BINDING SITE FOR RESIDUE CA A 151 source : AC3 16) chain A residue 129 type sequence D description BINDING SITE FOR RESIDUE CA A 152 source : AC4 17) chain A residue 131 type sequence D description BINDING SITE FOR RESIDUE CA A 152 source : AC4 18) chain A residue 133 type sequence D description BINDING SITE FOR RESIDUE CA A 152 source : AC4 19) chain A residue 135 type sequence H description BINDING SITE FOR RESIDUE CA A 152 source : AC4 20) chain A residue 140 type sequence E description BINDING SITE FOR RESIDUE CA A 152 source : AC4 21) chain A residue 21 type BINDING sequence K description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 22) chain A residue 68 type BINDING sequence F description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 23) chain A residue 94 type BINDING sequence R description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 24) chain A residue 96 type BINDING sequence G description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 25) chain A residue 98 type BINDING sequence G description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 26) chain A residue 105 type BINDING sequence L description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 27) chain A residue 130 type BINDING sequence I description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 28) chain A residue 132 type BINDING sequence G description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 29) chain A residue 134 type BINDING sequence G description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 30) chain A residue 136 type BINDING sequence I description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 31) chain A residue 141 type BINDING sequence F description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 32) chain A residue 23 type BINDING sequence G description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 33) chain A residue 25 type BINDING sequence G description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 34) chain A residue 27 type BINDING sequence I description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 35) chain A residue 32 type BINDING sequence L description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 36) chain A residue 57 type BINDING sequence A description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 37) chain A residue 59 type BINDING sequence G description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 38) chain A residue 61 type BINDING sequence G description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 39) chain A residue 63 type BINDING sequence I description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 40) chain A residue 14 type MOD_RES sequence E description N6,N6-dimethyllysine => ECO:0000269|PubMed:3100523 source Swiss-Prot : SWS_FT_FI3 41) chain A residue 116 type MOD_RES sequence L description N6,N6,N6-trimethyllysine => ECO:0000269|PubMed:3100523 source Swiss-Prot : SWS_FT_FI4 42) chain A residue 20-32 type prosite sequence DKDGDGTITTKEL description EF_HAND_1 EF-hand calcium-binding domain. DKDGDGTITtkEL source prosite : PS00018 43) chain A residue 56-68 type prosite sequence DADGNGTIDFPEF description EF_HAND_1 EF-hand calcium-binding domain. DKDGDGTITtkEL source prosite : PS00018 44) chain A residue 93-105 type prosite sequence DRDGNGLISAAEL description EF_HAND_1 EF-hand calcium-binding domain. DKDGDGTITtkEL source prosite : PS00018 45) chain A residue 129-141 type prosite sequence DIDGDGHINYEEF description EF_HAND_1 EF-hand calcium-binding domain. DKDGDGTITtkEL source prosite : PS00018

Display surface Download Links