eF-site ID 1cid-A
PDB Code 1cid
Chain A

click to enlarge
Title CRYSTAL STRUCTURE OF DOMAINS 3 & 4 OF RAT CD4 AND THEIR RELATIONSHIP TO THE NH2-TERMINAL DOMAINS
Classification T-CELL SURFACE GLYCOPROTEIN
Compound T CELL SURFACE GLYCOPROTEIN CD4
Source Rattus norvegicus (Rat) (CD4_RAT)
Sequence A:  TSITAYKSEGESAEFSFPLNLGEESLQGELRWKAEKAPSS
QSWITFSLKNQKVSVQKSTSNPKFQLSETLPLTLQIPQVS
LQFAGSGNLTLTLDRGILYQEVNLVVMKVTQPDSNTLTCE
VMGPTSPKMRLILKQENQEARVSRQEKVIQVQAPEAGVWQ
CLLSEGEEVKMDSKIQV
Description (1)  CD4 (DOMAINS 3 AND 4)

Display surface

Download
Links