eF-site ID 1ci7-AB PDB Code 1ci7 Chain A, B click to enlarge Title TERNARY COMPLEX OF THYMIDYLATE SYNTHASE FROM PNEUMOCYSTIS CARINII Classification TRANSFERASE Compound PROTEIN (THYMIDYLATE SYNTHASE) Source Pneumocystis carinii (TYSY_PNECA) Sequence A:  NAEEQQYLNLVQYIINHGEDRPDRTGTGTLSVFAPSPLKF SLRNKTFPLLTTKRVFIRGVIEELLWFIRGETDSLKLREK NIHIWDANGSREYLDSIGLTKRQEGDLGPIYGFQWRHFGA EYIDCKTNYIGQGVDQLANIIQKIRTSPYDRRLILSAWNP ADLEKMALPPCHMFCQFYVHIPSRPELSCQLYQRSCDMGL GVPFNIASYALLTCMIAHVCDLDPGDFIHVMGDCHIYKDH IEALQQQLTRSPRPFPTLSLNRSITDIEDFTLDDFNIQNY HPYETIKMKMSI B:  NAEEQQYLNLVQYIINHGEDRPDRTGTGTLSVFAPSPLKF SLRNKTFPLLTTKRVFIRGVIEELLWFIRGETDSLKLREK NIHIWDANGSREYLDSIGLTKRQEGDLGPIYGFQWRHFGA EYIDCKTNYIGQGVDQLANIIQKIRTSPYDRRLILSAWNP ADLEKMALPPCHMFCQFYVHIPSRPELSCQLYQRSCDMGL GVPFNIASYALLTCMIAHVCDLDPGDFIHVMGDCHIYKDH IEALQQQLTRSPRPFPTLSLNRSITDIEDFTLDDFNIQNY HPYETIKMKMSI Description Functional site 1) chain A residue 153 type sequence R description BINDING SITE FOR RESIDUE UMP B 765 source : AC1 2) chain A residue 154 type sequence R description BINDING SITE FOR RESIDUE UMP B 765 source : AC1 3) chain B residue 26 type sequence R description BINDING SITE FOR RESIDUE UMP B 765 source : AC1 4) chain B residue 170 type sequence L description BINDING SITE FOR RESIDUE UMP B 765 source : AC1 5) chain B residue 173 type sequence C description BINDING SITE FOR RESIDUE UMP B 765 source : AC1 6) chain B residue 199 type sequence R description BINDING SITE FOR RESIDUE UMP B 765 source : AC1 7) chain B residue 200 type sequence S description BINDING SITE FOR RESIDUE UMP B 765 source : AC1 8) chain B residue 201 type sequence C description BINDING SITE FOR RESIDUE UMP B 765 source : AC1 9) chain B residue 202 type sequence D description BINDING SITE FOR RESIDUE UMP B 765 source : AC1 10) chain B residue 210 type sequence N description BINDING SITE FOR RESIDUE UMP B 765 source : AC1 11) chain B residue 240 type sequence H description BINDING SITE FOR RESIDUE UMP B 765 source : AC1 12) chain B residue 242 type sequence Y description BINDING SITE FOR RESIDUE UMP B 765 source : AC1 13) chain A residue 26 type sequence R description BINDING SITE FOR RESIDUE UMP A 767 source : AC2 14) chain A residue 170 type sequence L description BINDING SITE FOR RESIDUE UMP A 767 source : AC2 15) chain A residue 173 type sequence C description BINDING SITE FOR RESIDUE UMP A 767 source : AC2 16) chain A residue 199 type sequence R description BINDING SITE FOR RESIDUE UMP A 767 source : AC2 17) chain A residue 200 type sequence S description BINDING SITE FOR RESIDUE UMP A 767 source : AC2 18) chain A residue 201 type sequence C description BINDING SITE FOR RESIDUE UMP A 767 source : AC2 19) chain A residue 202 type sequence D description BINDING SITE FOR RESIDUE UMP A 767 source : AC2 20) chain A residue 210 type sequence N description BINDING SITE FOR RESIDUE UMP A 767 source : AC2 21) chain A residue 240 type sequence H description BINDING SITE FOR RESIDUE UMP A 767 source : AC2 22) chain A residue 242 type sequence Y description BINDING SITE FOR RESIDUE UMP A 767 source : AC2 23) chain B residue 153 type sequence R description BINDING SITE FOR RESIDUE UMP A 767 source : AC2 24) chain B residue 154 type sequence R description BINDING SITE FOR RESIDUE UMP A 767 source : AC2 25) chain A residue 56 type sequence R description BINDING SITE FOR RESIDUE CB3 A 768 source : AC3 26) chain A residue 58 type sequence F description BINDING SITE FOR RESIDUE CB3 A 768 source : AC3 27) chain A residue 86 type sequence I description BINDING SITE FOR RESIDUE CB3 A 768 source : AC3 28) chain A residue 90 type sequence N description BINDING SITE FOR RESIDUE CB3 A 768 source : AC3 29) chain A residue 202 type sequence D description BINDING SITE FOR RESIDUE CB3 A 768 source : AC3 30) chain A residue 206 type sequence G description BINDING SITE FOR RESIDUE CB3 A 768 source : AC3 31) chain A residue 209 type sequence F description BINDING SITE FOR RESIDUE CB3 A 768 source : AC3 32) chain A residue 210 type sequence N description BINDING SITE FOR RESIDUE CB3 A 768 source : AC3 33) chain A residue 242 type sequence Y description BINDING SITE FOR RESIDUE CB3 A 768 source : AC3 34) chain A residue 295 type sequence M description BINDING SITE FOR RESIDUE CB3 A 768 source : AC3 35) chain A residue 296 type sequence S description BINDING SITE FOR RESIDUE CB3 A 768 source : AC3 36) chain A residue 173 type ACT_SITE sequence C description Nucleophile => ECO:0000250|UniProtKB:P0A884 source Swiss-Prot : SWS_FT_FI1 37) chain B residue 173 type ACT_SITE sequence C description Nucleophile => ECO:0000250|UniProtKB:P0A884 source Swiss-Prot : SWS_FT_FI1 38) chain A residue 26 type BINDING sequence R description in other chain => ECO:0000250|UniProtKB:P0A884 source Swiss-Prot : SWS_FT_FI2 39) chain A residue 199 type BINDING sequence R description in other chain => ECO:0000250|UniProtKB:P0A884 source Swiss-Prot : SWS_FT_FI2 40) chain A residue 210 type BINDING sequence N description in other chain => ECO:0000250|UniProtKB:P0A884 source Swiss-Prot : SWS_FT_FI2 41) chain A residue 240 type BINDING sequence H description in other chain => ECO:0000250|UniProtKB:P0A884 source Swiss-Prot : SWS_FT_FI2 42) chain B residue 26 type BINDING sequence R description in other chain => ECO:0000250|UniProtKB:P0A884 source Swiss-Prot : SWS_FT_FI2 43) chain B residue 199 type BINDING sequence R description in other chain => ECO:0000250|UniProtKB:P0A884 source Swiss-Prot : SWS_FT_FI2 44) chain B residue 210 type BINDING sequence N description in other chain => ECO:0000250|UniProtKB:P0A884 source Swiss-Prot : SWS_FT_FI2 45) chain B residue 240 type BINDING sequence H description in other chain => ECO:0000250|UniProtKB:P0A884 source Swiss-Prot : SWS_FT_FI2 46) chain A residue 153 type BINDING sequence R description BINDING => ECO:0000250|UniProtKB:P0A884 source Swiss-Prot : SWS_FT_FI3 47) chain A residue 202 type BINDING sequence D description BINDING => ECO:0000250|UniProtKB:P0A884 source Swiss-Prot : SWS_FT_FI3 48) chain B residue 153 type BINDING sequence R description BINDING => ECO:0000250|UniProtKB:P0A884 source Swiss-Prot : SWS_FT_FI3 49) chain B residue 202 type BINDING sequence D description BINDING => ECO:0000250|UniProtKB:P0A884 source Swiss-Prot : SWS_FT_FI3 50) chain A residue 153-181 type prosite sequence RRLILSAWNPADLEKMALPPCHMFCQFYV description THYMIDYLATE_SYNTHASE Thymidylate synthase active site. RrlIlsaWNpadlekma.....LpPCHmfcQFyV source prosite : PS00091

Display surface Download Links