eF-site ID 1ci7-A PDB Code 1ci7 Chain A click to enlarge Title TERNARY COMPLEX OF THYMIDYLATE SYNTHASE FROM PNEUMOCYSTIS CARINII Classification TRANSFERASE Compound PROTEIN (THYMIDYLATE SYNTHASE) Source Pneumocystis carinii (TYSY_PNECA) Sequence A:  NAEEQQYLNLVQYIINHGEDRPDRTGTGTLSVFAPSPLKF SLRNKTFPLLTTKRVFIRGVIEELLWFIRGETDSLKLREK NIHIWDANGSREYLDSIGLTKRQEGDLGPIYGFQWRHFGA EYIDCKTNYIGQGVDQLANIIQKIRTSPYDRRLILSAWNP ADLEKMALPPCHMFCQFYVHIPSRPELSCQLYQRSCDMGL GVPFNIASYALLTCMIAHVCDLDPGDFIHVMGDCHIYKDH IEALQQQLTRSPRPFPTLSLNRSITDIEDFTLDDFNIQNY HPYETIKMKMSI Description Functional site 1) chain A residue 153 type sequence R description BINDING SITE FOR RESIDUE UMP B 765 source : AC1 2) chain A residue 154 type sequence R description BINDING SITE FOR RESIDUE UMP B 765 source : AC1 3) chain A residue 26 type sequence R description BINDING SITE FOR RESIDUE UMP A 767 source : AC2 4) chain A residue 170 type sequence L description BINDING SITE FOR RESIDUE UMP A 767 source : AC2 5) chain A residue 173 type sequence C description BINDING SITE FOR RESIDUE UMP A 767 source : AC2 6) chain A residue 199 type sequence R description BINDING SITE FOR RESIDUE UMP A 767 source : AC2 7) chain A residue 200 type sequence S description BINDING SITE FOR RESIDUE UMP A 767 source : AC2 8) chain A residue 201 type sequence C description BINDING SITE FOR RESIDUE UMP A 767 source : AC2 9) chain A residue 202 type sequence D description BINDING SITE FOR RESIDUE UMP A 767 source : AC2 10) chain A residue 210 type sequence N description BINDING SITE FOR RESIDUE UMP A 767 source : AC2 11) chain A residue 240 type sequence H description BINDING SITE FOR RESIDUE UMP A 767 source : AC2 12) chain A residue 242 type sequence Y description BINDING SITE FOR RESIDUE UMP A 767 source : AC2 13) chain A residue 56 type sequence R description BINDING SITE FOR RESIDUE CB3 A 768 source : AC3 14) chain A residue 58 type sequence F description BINDING SITE FOR RESIDUE CB3 A 768 source : AC3 15) chain A residue 86 type sequence I description BINDING SITE FOR RESIDUE CB3 A 768 source : AC3 16) chain A residue 90 type sequence N description BINDING SITE FOR RESIDUE CB3 A 768 source : AC3 17) chain A residue 202 type sequence D description BINDING SITE FOR RESIDUE CB3 A 768 source : AC3 18) chain A residue 206 type sequence G description BINDING SITE FOR RESIDUE CB3 A 768 source : AC3 19) chain A residue 209 type sequence F description BINDING SITE FOR RESIDUE CB3 A 768 source : AC3 20) chain A residue 210 type sequence N description BINDING SITE FOR RESIDUE CB3 A 768 source : AC3 21) chain A residue 242 type sequence Y description BINDING SITE FOR RESIDUE CB3 A 768 source : AC3 22) chain A residue 295 type sequence M description BINDING SITE FOR RESIDUE CB3 A 768 source : AC3 23) chain A residue 296 type sequence S description BINDING SITE FOR RESIDUE CB3 A 768 source : AC3 24) chain A residue 173 type ACT_SITE sequence C description Nucleophile => ECO:0000250|UniProtKB:P0A884 source Swiss-Prot : SWS_FT_FI1 25) chain A residue 26 type BINDING sequence R description in other chain => ECO:0000250|UniProtKB:P0A884 source Swiss-Prot : SWS_FT_FI2 26) chain A residue 199 type BINDING sequence R description in other chain => ECO:0000250|UniProtKB:P0A884 source Swiss-Prot : SWS_FT_FI2 27) chain A residue 210 type BINDING sequence N description in other chain => ECO:0000250|UniProtKB:P0A884 source Swiss-Prot : SWS_FT_FI2 28) chain A residue 240 type BINDING sequence H description in other chain => ECO:0000250|UniProtKB:P0A884 source Swiss-Prot : SWS_FT_FI2 29) chain A residue 153 type BINDING sequence R description BINDING => ECO:0000250|UniProtKB:P0A884 source Swiss-Prot : SWS_FT_FI3 30) chain A residue 202 type BINDING sequence D description BINDING => ECO:0000250|UniProtKB:P0A884 source Swiss-Prot : SWS_FT_FI3 31) chain A residue 153-181 type prosite sequence RRLILSAWNPADLEKMALPPCHMFCQFYV description THYMIDYLATE_SYNTHASE Thymidylate synthase active site. RrlIlsaWNpadlekma.....LpPCHmfcQFyV source prosite : PS00091

Display surface Download Links