eF-site ID 1ch7-A
PDB Code 1ch7
Chain A

click to enlarge
Title RECOMBINANT SPERM WHALE MYOGLOBIN H97F MUTANT (MET)
Classification OXYGEN STORAGE/TRANSPORT
Compound PROTEIN (MYOGLOBIN)
Source Physeter macrocephalus (Sperm whale) (Physeter catodon) (MYG_PHYCA)
Sequence A:  MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPET
LEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKK
GHHEAELKPLAQSHATKFKIPIKYLEFISEAIIHVLHSRH
PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG
Description (1)  MYOGLOBIN


Functional site

1) chain A
residue 3
type
ligand
sequence S
description BINDING SITE FOR RESIDUE SO4 A 156
source : AC1

2) chain A
residue 4
type
ligand
sequence E
description BINDING SITE FOR RESIDUE SO4 A 156
source : AC1

3) chain A
residue 51
type
ligand
sequence T
description BINDING SITE FOR RESIDUE SO4 A 156
source : AC1

4) chain A
residue 52
type
ligand
sequence E
description BINDING SITE FOR RESIDUE SO4 A 156
source : AC1

5) chain A
residue 53
type
ligand
sequence A
description BINDING SITE FOR RESIDUE SO4 A 156
source : AC1

6) chain A
residue 42
type
ligand
sequence K
description BINDING SITE FOR RESIDUE HEM A 154
source : AC2

7) chain A
residue 43
type
ligand
sequence F
description BINDING SITE FOR RESIDUE HEM A 154
source : AC2

8) chain A
residue 45
type
ligand
sequence R
description BINDING SITE FOR RESIDUE HEM A 154
source : AC2

9) chain A
residue 64
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM A 154
source : AC2

10) chain A
residue 89
type
ligand
sequence L
description BINDING SITE FOR RESIDUE HEM A 154
source : AC2

11) chain A
residue 92
type
ligand
sequence S
description BINDING SITE FOR RESIDUE HEM A 154
source : AC2

12) chain A
residue 93
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM A 154
source : AC2

13) chain A
residue 97
type
ligand
sequence F
description BINDING SITE FOR RESIDUE HEM A 154
source : AC2

14) chain A
residue 99
type
ligand
sequence I
description BINDING SITE FOR RESIDUE HEM A 154
source : AC2

15) chain A
residue 103
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE HEM A 154
source : AC2

16) chain A
residue 104
type
ligand
sequence L
description BINDING SITE FOR RESIDUE HEM A 154
source : AC2

17) chain A
residue 65
type METAL
ligand
sequence G
description Iron (heme distal ligand)
source Swiss-Prot : SWS_FT_FI1

18) chain A
residue 94
type METAL
ligand
sequence A
description Iron (heme proximal ligand)
source Swiss-Prot : SWS_FT_FI2

19) chain A
residue 32
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence L
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1ch7_A_154

20) chain A
residue 39
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence T
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1ch7_A_154

21) chain A
residue 42-43
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence KF
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1ch7_A_154

22) chain A
residue 45
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence R
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1ch7_A_154

23) chain A
residue 64
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence H
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1ch7_A_154

24) chain A
residue 67-68
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence TV
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1ch7_A_154

25) chain A
residue 71-72
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence AL
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1ch7_A_154

26) chain A
residue 88-89
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence PL
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1ch7_A_154

27) chain A
residue 92-93
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence SH
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1ch7_A_154

28) chain A
residue 96-97
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence KF
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1ch7_A_154

29) chain A
residue 99
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence I
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1ch7_A_154

30) chain A
residue 103-104
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence YL
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1ch7_A_154

31) chain A
residue 107
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence I
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1ch7_A_154

32) chain A
residue 111
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence I
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1ch7_A_154

33) chain A
residue 138
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence F
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_1ch7_A_154


Display surface

Download
Links