eF-site ID 1cee_17-A PDB Code 1cee Model 17 Chain A click to enlarge Title SOLUTION STRUCTURE OF CDC42 IN COMPLEX WITH THE GTPASE BINDING DOMAIN OF WASP Classification Structural protein Regulation Compound GTP-BINDING RHO-LIKE PROTEIN Source Homo sapiens (Human) (WASP_HUMAN) Sequence A:  MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNY AVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLV CFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSAL TQKGLKNVFDEAILAALEP Description Functional site 1) chain A residue 17 type sequence T description BINDING SITE FOR RESIDUE MG A 180 source : AC1 2) chain A residue 35 type sequence T description BINDING SITE FOR RESIDUE MG A 180 source : AC1 3) chain A residue 12 type sequence G description BINDING SITE FOR RESIDUE GCP A 181 source : AC2 4) chain A residue 13 type sequence A description BINDING SITE FOR RESIDUE GCP A 181 source : AC2 5) chain A residue 14 type sequence V description BINDING SITE FOR RESIDUE GCP A 181 source : AC2 6) chain A residue 15 type sequence G description BINDING SITE FOR RESIDUE GCP A 181 source : AC2 7) chain A residue 16 type sequence K description BINDING SITE FOR RESIDUE GCP A 181 source : AC2 8) chain A residue 17 type sequence T description BINDING SITE FOR RESIDUE GCP A 181 source : AC2 9) chain A residue 18 type sequence C description BINDING SITE FOR RESIDUE GCP A 181 source : AC2 10) chain A residue 28 type sequence F description BINDING SITE FOR RESIDUE GCP A 181 source : AC2 11) chain A residue 35 type sequence T description BINDING SITE FOR RESIDUE GCP A 181 source : AC2 12) chain A residue 118 type sequence D description BINDING SITE FOR RESIDUE GCP A 181 source : AC2 13) chain A residue 158 type sequence S description BINDING SITE FOR RESIDUE GCP A 181 source : AC2 14) chain A residue 159 type sequence A description BINDING SITE FOR RESIDUE GCP A 181 source : AC2 15) chain A residue 160 type sequence L description BINDING SITE FOR RESIDUE GCP A 181 source : AC2 16) chain A residue 10 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI1 17) chain A residue 115 type BINDING sequence T description source Swiss-Prot : SWS_FT_FI1 18) chain A residue 35 type CARBOHYD sequence T description (Microbial infection) O-linked (Glc) threonine; by C.difficile toxins TcdA and TcdB; alternate => ECO:0000269|PubMed:24905543, ECO:0000269|PubMed:7775453, ECO:0000269|PubMed:7777059 source Swiss-Prot : SWS_FT_FI7 19) chain A residue 32 type CARBOHYD sequence Y description (Microbial infection) O-linked (GlcNAc) tyrosine; by Photorhabdus PAU_02230; alternate => ECO:0000269|PubMed:24141704 source Swiss-Prot : SWS_FT_FI6 20) chain A residue 57 type BINDING sequence D description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 21) chain A residue 32 type MOD_RES sequence Y description (Microbial infection) O-AMP-tyrosine; by Haemophilus IbpA; alternate => ECO:0000269|PubMed:19362538, ECO:0000269|PubMed:20622875 source Swiss-Prot : SWS_FT_FI3 22) chain A residue 35 type MOD_RES sequence T description (Microbial infection) O-AMP-threonine; by Vibrio VopS => ECO:0000269|PubMed:19039103 source Swiss-Prot : SWS_FT_FI4 23) chain A residue 64 type MOD_RES sequence Y description Phosphotyrosine; by SRC => ECO:0000269|PubMed:14506284 source Swiss-Prot : SWS_FT_FI5

Display surface Download Links